Recombinant Paracoccus denitrificans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
nuoK; nqo11; Pden_2234; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NADH dehydrogenase I, subunit 11; NADH-quinone oxidoreductase subunit 11; NQO11; NDH-1 subunit K; NDH-1, subunit 11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Paracoccus denitrificans (strain Pd 1222)
Target Names
nuoK
Target Protein Sequence
MIGLTHYLVVGAILFVTGIFGIFVNRKNVIVILMSIELMLLAVNINFVAFSTHLGDLAGQ VFTMFVLTVAAAEAAIGLAILVVFFRNRGTIAVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. The immediate electron acceptor for this enzyme in this species is believed to be ubiquinone. This process couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), conserving the redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NuoK in the NADH-quinone oxidoreductase complex?

NuoK is a small but critical subunit of the proton-translocating NADH-quinone oxidoreductase (NDH-1) complex in Paracoccus denitrificans. It functions as part of the membrane domain and plays an essential role in the coupling mechanism of electron transfer to proton translocation. NuoK is homologous to the mitochondrial ND4L subunit, which is the smallest mitochondrial DNA-encoded subunit of complex I . As a membrane-embedded component, NuoK contributes to the architecture of the proton translocation pathway and maintains the structural integrity of the entire complex. Research indicates that NuoK contains highly conserved acidic residues that are crucial for the energy-transducing activities of NDH-1 .

P. denitrificans has served as a model organism for studying respiratory complexes since its isolation in 1908, and its NDH-1 complex has been extensively characterized due to its similarity to mitochondrial complex I . Understanding NuoK's function provides significant insights into bioenergetic mechanisms across various species and contributes to our fundamental knowledge of cellular respiration processes.

How does the structure of nuoK relate to its function in proton translocation?

The structure of nuoK is characterized by multiple transmembrane helices with highly conserved residues positioned strategically within the membrane domain. Key to its function are conserved acidic residues, particularly glutamic acid residues that are embedded within the membrane region. These residues are believed to participate directly in proton translocation or in creating a pathway for proton movement across the membrane .

Structural studies indicate that nuoK (like its E. coli homolog) contains conserved glutamic acids (corresponding to Glu-36 and Glu-72 in E. coli) that when mutated lead to almost complete loss of coupled electron transfer activities and disruption of electrochemical gradient generation . This suggests these membrane-embedded acidic residues are critical for the coupling mechanism of NDH-1. Additionally, conserved arginine residues located on the cytosolic side of the protein appear to play important roles in the functional mechanics of the complex, as their mutation severely impairs coupled activities .

What are the optimal methods for recombinant expression of P. denitrificans nuoK?

The recombinant expression of P. denitrificans nuoK requires careful consideration of several factors due to its hydrophobic nature and integral membrane protein characteristics. While the search results don't provide specific protocols for nuoK expression, successful approaches for similar membrane proteins can be adapted. Based on research with related subunits, a homologous expression system is often preferred to ensure proper folding and integration into the membrane .

For heterologous expression, E. coli expression systems using vectors with inducible promoters (such as pET or pBAD series) have proven effective for similar membrane proteins. Expression should be conducted at lower temperatures (typically 18-25°C) after induction to allow proper folding. Membrane fractionation using ultracentrifugation following cell lysis is essential for isolation of the expressed protein. For purification, detergent solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin helps maintain protein structure and function.

To verify successful expression, techniques such as blue-native gel electrophoresis and immunostaining with specific antibodies are recommended, as demonstrated in studies of NDH-1 complexes .

How can researchers assess the functional integrity of recombinantly expressed nuoK?

Assessing the functional integrity of recombinantly expressed nuoK requires multiple complementary approaches focusing on both structural integration and functional activity. Based on established methodologies for NDH-1 components, the following techniques are recommended:

  • Enzymatic activity assays: Three types of assays are commonly employed to evaluate NDH-1 function:

    • dNADH oxidase activity

    • dNADH-Q oxidoreductase activity

    • dNADH dehydrogenase (dNADH-K₃Fe(CN)₆ reductase) activity

  • Blue-native gel electrophoresis (BN-PAGE): This technique allows visualization of the intact NDH-1 complex, confirming proper assembly of nuoK within the larger structure .

  • Immunochemical analysis: Using antibodies specific to nuoK or other NDH-1 subunits to confirm expression and membrane association .

  • Membrane extraction studies: Treatments with chaotropic reagents (urea, NaI, or NaBr) or alkaline buffer (pH 10-12) to assess membrane integration properties of the recombinant protein .

  • Proton pumping assays: Evaluating the generation of electrochemical gradient in membrane vesicles containing the recombinant protein, which directly assesses the coupling function of nuoK .

These complementary approaches provide a comprehensive evaluation of both the structural and functional integrity of the recombinantly expressed nuoK protein.

Which conserved residues of nuoK are critical for function, and how should mutagenesis studies be designed?

Based on extensive mutational analyses of related NDH-1 components, several key conserved residues in nuoK are critical for function. When designing mutagenesis studies, researchers should focus on the following:

Key target residues:

  • Highly conserved acidic residues, particularly glutamic acids within transmembrane domains, which are likely directly involved in proton translocation. These correspond to residues like Glu-36 and Glu-72 in the E. coli homolog, whose mutation leads to almost complete loss of coupled electron transfer and disruption of electrochemical gradient generation .

  • Conserved arginine residues on cytosolic loops that when mutated severely impair coupled activities .

  • Based on studies of related subunits, acidic residues like Glu-138, Glu-140, and Asp-143 (as identified in the NuoC segment) may play pivotal roles in structural stability and should be investigated in nuoK as well .

Mutagenesis design strategies:

  • Employ conservative substitutions (e.g., E→D, R→K) to assess the importance of specific chemical properties versus mere charge presence.

  • Use non-conservative substitutions (e.g., E→A, E→Q) to completely eliminate charge effects.

  • Implement chromosomal gene manipulation techniques for physiologically relevant expression levels, as demonstrated in previous NDH-1 studies .

  • Create a knockout control strain alongside point mutants to establish baseline activity levels.

  • Include a reversion control (as with the KO-C-rev strain described) to verify that the genetic manipulation process itself doesn't affect function .

This systematic approach allows for comprehensive evaluation of the structure-function relationships of critical residues in nuoK.

How do mutations in membrane-embedded glutamic acid residues affect the coupling mechanism of nuoK?

Mutations in membrane-embedded glutamic acid residues profoundly affect the coupling mechanism of nuoK, revealing their critical importance in NDH-1 function. Research on homologous systems shows that these acidic residues located within transmembrane domains are essential for energy transduction and proton translocation.

When nearly perfectly conserved glutamic acid residues (such as Glu-36 in E. coli) are mutated, there is almost complete loss of coupled electron transfer activities with concomitant loss of electrochemical gradient generation . Similarly, mutations of other highly conserved glutamic acid residues (like Glu-72) result in significant diminution of coupled activities . These findings demonstrate that membrane-embedded acidic residues are crucial components of the coupling mechanism.

The specific effects of mutations depend on the type of amino acid substitution:

  • Non-conservative substitutions (E→A) typically result in the most severe functional impairment

  • Even conservative substitutions (E→D) often significantly reduce activity

  • Intermediate effects are observed with E→Q mutations that maintain size but eliminate charge

This pattern suggests that both the precise positioning and the negative charge of these glutamic acid residues are essential for proper function. The precise mechanism likely involves these residues participating directly in proton binding and release during the translocation process, or in maintaining critical protein conformations necessary for energy coupling.

How does nuoK integrate into the membrane domain of the NDH-1 complex?

The integration of nuoK into the membrane domain of the NDH-1 complex involves specific structural features and interactions that ensure proper assembly and function of the respiratory complex. Based on studies of NDH-1 components, nuoK is firmly embedded within the membrane arm of the L-shaped enzyme complex .

The NDH-1 complex of P. denitrificans consists of at least 14 subunits and is organized into two major domains: the peripheral arm extending into the cytoplasm and the membrane arm integrated into the cytoplasmic membrane . NuoK, as part of the membrane domain (alongside subunits NuoA, NuoH, NuoJ, NuoL, NuoM, and NuoN), contributes to the architecture of the proton translocation pathway .

Integration of nuoK likely depends on hydrophobic transmembrane helices that anchor the protein in the lipid bilayer. Studies of NDH-1 using chaotropic reagents (urea, NaI, or NaBr) and alkaline buffer treatments demonstrated that some subunits remain membrane-associated while others are extracted, revealing the strength of membrane integration of different components . This suggests that nuoK, like other membrane domain subunits, contains hydrophobic regions that facilitate direct association with the membrane portion of the enzyme complex.

Additionally, the proper integration of nuoK appears to depend on interactions with neighboring subunits in the membrane domain, which collectively form the proton translocation apparatus of the complex.

What techniques can be used to study subunit-subunit interactions involving nuoK?

Studying subunit-subunit interactions involving nuoK requires sophisticated approaches that can reveal membrane protein associations while maintaining native-like conditions. Several complementary techniques are particularly valuable for this purpose:

  • Chemical cross-linking followed by mass spectrometry: This approach can identify interacting partners by covalently linking spatially proximate residues before protein complex disruption for analysis. Using membrane-permeable cross-linkers with different spacer arm lengths can map the distance relationships between nuoK and other subunits.

  • Blue-native gel electrophoresis (BN-PAGE): This technique separates intact membrane protein complexes and, when combined with second-dimension SDS-PAGE, can resolve individual subunits that associate with nuoK . The presence or absence of nuoK in subcomplexes can be detected using specific antibodies.

  • Chaotropic agent treatments: Exposing membranes to chaotropic reagents (urea, NaI, or NaBr) or alkaline buffer (pH 10-12) differentially extracts subunits based on their membrane association strength, revealing which subunits directly interact with nuoK .

  • Co-immunoprecipitation using nuoK-specific antibodies: This can pull down interaction partners from detergent-solubilized membranes, particularly when performed with mild detergents that preserve protein-protein interactions.

  • Mutational analysis combined with assembly studies: Systematic mutations in nuoK followed by analysis of complex assembly using BN-PAGE and immunoblotting can identify regions critical for interactions with other subunits .

  • Cysteine scanning mutagenesis and site-directed cross-linking: Introduction of cysteine residues at specific positions in nuoK and partner subunits can facilitate disulfide bond formation between interacting regions, revealing proximity relationships.

These approaches provide complementary information about the structural integration of nuoK within the NDH-1 complex.

What assays are most appropriate for measuring nuoK-specific contributions to NDH-1 activity?

  • dNADH oxidase activity assay: This measures the complete electron transfer pathway from NADH to oxygen via the respiratory chain. Researchers should use dNADH rather than NADH as substrate to specifically target NDH-1 activity (as NDH-2 cannot oxidize dNADH) . Typical values for wild-type activity are approximately 659 nmol of dNADH oxidized/mg of protein/min .

  • dNADH-quinone oxidoreductase assay: Using artificial quinone analogs like decylubiquinone (DB) allows measurement of electron transfer from NADH to the quinone, isolating the function of the NDH-1 complex from downstream respiratory components. Wild-type values are around 636 nmol of dNADH oxidized/mg of protein/min .

  • dNADH-K₃Fe(CN)₆ reductase assay: This measures the activity of the peripheral arm independent of the membrane domain, providing crucial information about whether nuoK mutations affect only proton translocation or also electron transfer. Typical wild-type values are approximately 1816 nmol of K₃Fe(CN)₆ reduced/mg of protein/min .

  • Proton pumping assays: Measuring the generation of membrane potential or pH gradient in membrane vesicles can directly assess the proton translocation function that nuoK contributes to.

  • Comparative analysis of nuoK variants: Creating a series of point mutations in conserved residues of nuoK and comparing their effects across multiple assays provides the most comprehensive picture of nuoK-specific functions. The table below shows example data for related NDH-1 mutations:

MutationdNADH-K₃Fe(CN)₆ activity (%)dNADH oxidase activity (%)dNADH-DB activity (%)
Wild type100100100
Knockout3613
E138A4923
E140D9485104
D143E103132128

This approach differentiates between residues essential for structural integrity versus those specifically involved in catalytic or proton translocation functions .

How can researchers distinguish between assembly defects and functional defects in nuoK mutants?

Distinguishing between assembly defects and functional defects in nuoK mutants is crucial for correctly interpreting experimental results. Several complementary approaches can be employed to make this distinction:

Using this multi-faceted approach, researchers can confidently determine whether a particular nuoK mutation affects complex assembly or specifically impairs the functional mechanisms of an otherwise properly assembled complex.

How does the P. denitrificans nuoK compare with homologous subunits in other organisms?

The P. denitrificans nuoK shares significant homology with corresponding subunits in other prokaryotic and eukaryotic organisms, reflecting the evolutionary conservation of NADH-quinone oxidoreductase/Complex I across species. This conservation allows for valuable comparative analyses:

In prokaryotic systems, the P. denitrificans nuoK is homologous to the NuoK subunit in Escherichia coli and the Nqo11 subunit in Thermus thermophilus. These subunits share conserved structural features, particularly the membrane-embedded glutamic acid residues that are crucial for proton translocation . The bacterial NDH-1 complex from P. denitrificans contains at least 14 subunits (NQO1-14) similar to other bacterial systems .

In eukaryotic mitochondria, nuoK corresponds to the ND4L subunit of Complex I, which is notably one of the few subunits encoded by mitochondrial DNA rather than nuclear DNA . This evolutionary conservation of mitochondrial encoding suggests the critical importance of this subunit in energy transduction.

Key conserved features across species include:

  • Multiple transmembrane helices anchoring the protein in the membrane

  • Highly conserved glutamic acid residues within transmembrane domains

  • Conserved arginine residues on cytosolic loops

  • Similar topological arrangement within the membrane domain of the complex

Despite this conservation, there are species-specific differences in the precise number of transmembrane helices and in some of the connecting loops. The P. denitrificans enzyme has long been valued as a model system for studying respiratory complexes due to its similarity to mitochondrial complexes while offering the experimental advantages of a bacterial system .

What insights can be gained from studying nuoK in P. denitrificans versus other model organisms?

Studying nuoK in Paracoccus denitrificans offers distinct advantages and insights compared to investigations in other model organisms, particularly in understanding fundamental mechanisms of bioenergetics:

Unique advantages of P. denitrificans as a model:

  • P. denitrificans has been established as a model organism for studying denitrification since its isolation in 1908, offering a wealth of accumulated knowledge and research tools .

  • Its respiratory chain closely resembles that of mitochondria, making it an excellent prokaryotic model for understanding eukaryotic bioenergetics.

  • Unlike some other bacterial systems, P. denitrificans can grow under both aerobic and anaerobic conditions, allowing for versatile experimental setups .

  • The genome of P. denitrificans is fully sequenced and annotated, facilitating genetic manipulation and analysis .

Comparative insights from cross-species studies:

  • Functional conservation: Studies comparing nuoK function across species reveal the fundamental mechanisms of proton translocation that have been conserved throughout evolution.

  • Structural variations: Differences in specific residues or structural elements between P. denitrificans nuoK and homologs in other species can highlight which features are absolutely essential versus those that can tolerate variation.

  • Environmental adaptations: P. denitrificans thrives in soil environments and has adapted its respiratory complexes accordingly, potentially revealing how environmental pressures shape the evolution of these systems .

  • Assembly process variations: Comparing how nuoK integrates into the NDH-1 complex in different organisms provides insights into the assembly pathways and potential auxiliary factors involved.

Ultimately, the value of P. denitrificans lies in its position as an excellent compromise between experimental tractability and relevance to mitochondrial systems. The insights gained from nuoK studies in this organism can be readily translated to understanding human mitochondrial disorders associated with Complex I dysfunction, while offering the advantages of a prokaryotic experimental system.

How can structural data from nuoK be applied to understanding proton translocation mechanisms?

Structural data from nuoK provides critical insights into the molecular mechanisms of proton translocation in respiratory complexes. By analyzing the three-dimensional arrangement of key residues, researchers can develop detailed models of how protons are transported across the membrane:

The conserved glutamic acid residues in transmembrane helices of nuoK are positioned to participate directly in proton movement. Studies show that mutations of these residues (such as Glu-36 and Glu-72 in the E. coli homolog) lead to almost complete loss of coupled electron transfer activities and disruption of electrochemical gradient generation . Structural analysis reveals these residues likely form part of a proton wire or channel that facilitates controlled proton movement across the membrane.

Additionally, structural data showing the relationship between nuoK and other membrane subunits reveals how conformational changes during the catalytic cycle might be transmitted from the site of quinone reduction to the proton translocation machinery. This mechanical coupling is essential for energy conservation during respiration.

3D structural models based on crystallographic data from related organisms (such as Thermus thermophilus) can be used to generate homology models of P. denitrificans nuoK . These models allow researchers to:

By integrating structural data with functional studies of site-directed mutants, researchers can develop and refine mechanistic models of how electron transfer is coupled to proton translocation across the membrane.

What are the most challenging technical aspects of working with recombinant nuoK, and how can they be addressed?

Working with recombinant nuoK presents several significant technical challenges due to its nature as a small, hydrophobic membrane protein involved in a complex multisubunit enzyme. These challenges and their potential solutions include:

1. Expression and solubility issues:

  • Challenge: As a hydrophobic membrane protein, nuoK is difficult to express in recombinant systems and tends to aggregate when overexpressed.

  • Solution: Use specialized expression systems with regulated, mild induction. Consider fusion partners that enhance solubility, such as maltose-binding protein (MBP) or SUMO tags, with subsequent tag removal. Expression in membrane-mimetic environments or direct expression into nanodiscs can also improve proper folding.

2. Functional reconstitution:

  • Challenge: Isolated nuoK must be properly reconstituted into a functional environment to study its specific roles.

  • Solution: Develop protocols for reconstitution into liposomes or nanodiscs that mimic the native membrane environment. Co-expression with interacting partners from the NDH-1 complex can help maintain structural integrity and function.

3. Structural analysis:

  • Challenge: The small size and hydrophobic nature of nuoK make traditional structural determination methods challenging.

  • Solution: Employ newer cryo-EM techniques that have proven successful for membrane protein complexes. Consider fusion with crystallization chaperones for X-ray crystallography attempts. NMR studies with isotope-labeled protein in detergent micelles or nanodiscs can provide structural data for smaller membrane proteins.

4. Distinguishing direct effects from indirect consequences:

  • Challenge: Mutations in nuoK may have ripple effects throughout the NDH-1 complex, making it difficult to distinguish direct functional contributions.

  • Solution: Employ comprehensive approaches analyzing both structural integrity (BN-PAGE, cross-linking) and functional parameters across multiple assays . Compare the patterns of effects with those from mutations in other subunits to identify nuoK-specific signatures.

5. Establishing physiologically relevant expression levels:

  • Challenge: Overexpression can lead to artifacts, while low expression yields insufficient material for analysis.

  • Solution: Use chromosomal integration techniques for expression at near-native levels, as demonstrated in similar studies . Alternatively, develop tightly regulated expression systems with promoters that allow fine-tuning of expression levels.

By addressing these technical challenges with appropriate methodologies, researchers can obtain more reliable and physiologically relevant data on nuoK function and its role in the NDH-1 complex.

What emerging technologies might advance our understanding of nuoK function?

Several emerging technologies hold significant promise for advancing our understanding of nuoK function in the NDH-1 complex:

  • Cryo-electron microscopy (cryo-EM) advances: Recent developments in cryo-EM technology have revolutionized structural biology of membrane proteins. Single-particle cryo-EM and tomography can potentially reveal the structure of nuoK within the intact NDH-1 complex at near-atomic resolution, providing unprecedented insights into how this subunit contributes to the proton translocation machinery.

  • Time-resolved spectroscopy: Advanced spectroscopic techniques with picosecond to millisecond resolution can capture conformational changes and proton movement during the catalytic cycle, revealing the dynamics of nuoK's contribution to energy transduction.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of nuoK that undergo conformational changes during catalysis by measuring the exchange rates of backbone amide hydrogens, providing insights into dynamic aspects of function.

  • Optogenetic approaches: Development of light-sensitive variants of nuoK or its interaction partners could allow precise temporal control of NDH-1 activity, enabling real-time observation of proton translocation events.

  • Single-molecule techniques: Advances in single-molecule fluorescence resonance energy transfer (FRET) and force microscopy could reveal heterogeneity and conformational states of individual NDH-1 complexes that are obscured in ensemble measurements.

  • Artificial intelligence and molecular dynamics simulations: Enhanced computational approaches can model proton movement through nuoK and the entire membrane domain with increasing accuracy, generating testable hypotheses about the mechanisms of proton translocation.

  • CRISPR-based screening approaches: High-throughput mutagenesis combined with selection for NDH-1 function could identify previously unrecognized regions of nuoK that contribute to its role in the complex.

These technologies, particularly when used in complementary approaches, have the potential to resolve long-standing questions about the precise mechanism of proton translocation and energy coupling in this fundamental bioenergetic complex.

How might research on nuoK contribute to our broader understanding of bioenergetic mechanisms?

Research on the nuoK subunit of NADH-quinone oxidoreductase has far-reaching implications for our broader understanding of bioenergetic mechanisms across all domains of life:

  • Fundamental principles of energy transduction: NuoK's role in coupling electron transfer to proton translocation represents one of the most basic and ancient mechanisms of biological energy conversion. Detailed mechanistic understanding of how this coupling occurs in nuoK will illuminate general principles applicable to other energy-transducing systems.

  • Evolutionary conservation of respiratory complexes: Comparative analysis of nuoK across species reveals the core functional elements that have been preserved throughout evolution from bacteria to humans. This evolutionarily conserved machinery provides insights into the earliest development of respiratory chains and mitochondria .

  • Mitochondrial disease mechanisms: The nuoK subunit's homolog in mitochondria (ND4L) is associated with several human mitochondrial disorders. Understanding the structure-function relationships in the bacterial model provides mechanistic insights into pathological processes affecting mitochondrial Complex I function in humans.

  • Biomimetic applications: Detailed knowledge of the proton translocation mechanism in nuoK could inspire the development of artificial molecular machines for energy conversion, potentially contributing to renewable energy technologies.

  • Antibiotic development: The structural and functional differences between bacterial NDH-1 and mammalian Complex I could be exploited for the development of antibacterial compounds that specifically target bacterial energy production.

  • Environmental adaptation mechanisms: Studying how nuoK functions in organisms adapted to different environments (like the soil bacterium P. denitrificans) reveals how energy transduction systems evolve to meet specific ecological challenges .

  • Quantum biological effects: Recent proposals suggest that proton translocation may involve quantum mechanical effects like tunneling. NuoK research could provide experimental systems to test these theoretical models.

By elucidating the fundamental mechanisms of how nuoK contributes to energy transduction, researchers gain insights applicable to diverse fields ranging from evolutionary biology and medicine to synthetic biology and renewable energy technology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.