Recombinant Paracoccus denitrificans Nucleoside diphosphate kinase (ndk)

What is the molecular structure of P. denitrificans NDK?

The P. denitrificans NDK (NRDI) consists of 138 amino acids with the following sequence:

MGGLVYFSSGSGNTARFVTRLGLPAGRIPISPRDEMPAPALPYVLICPTYADGMGRGAVPKQVIRFLNDPDRRALLRGVIATGNRNFGATYALAGRVISDKCNVPVLYRFELAGTDLDISRVQAGLAKFWGTECLTMA

The protein is cataloged under UniProt ID A1BA96 . While detailed structural studies of P. denitrificans NDK are not available in the search results, comparison with NDKs from other bacterial species suggests it likely forms oligomeric structures critical for its catalytic function.

How does bacterial NDK differ from eukaryotic counterparts?

While the search results don't provide a direct comparison between P. denitrificans NDK and eukaryotic versions, research on P. aeruginosa NDK indicates substantial homology with eukaryotic NDKs (39.9 to 58.3% amino acid identity) . This conservation suggests fundamental catalytic mechanisms are preserved across domains of life, though bacterial NDKs generally:

• Are smaller in size

• May have different regulatory mechanisms

• Often show distinct subcellular localization patterns

• Can exhibit specialized roles in bacterial metabolism not present in eukaryotes

What are the optimal conditions for recombinant expression of P. denitrificans NDK?

Based on available technical information for recombinant P. denitrificans NRDI protein, the following conditions are recommended:

• Expression system: Heterologous expression systems like E. coli are suitable

• Purification: Standard affinity chromatography techniques yield high purity (>85% as determined by SDS-PAGE)

• Storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

• Protein format: The recombinant protein can be supplied as a lyophilized powder

Researchers should note that the protein may contain N-terminal or C-terminal tags based on stability requirements, which should be considered in experimental design .

What are the recommended storage and handling protocols for recombinant P. denitrificans NDK?

For optimal stability and activity, follow these guidelines:

• Reconstitution protocol:

  • Briefly centrifuge lyophilized product before opening

  • Reconstitute to 0.1-1.0 mg/mL using deionized sterile water

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

• Storage conditions:

  • Store lyophilized protein at -20°C/-80°C (shelf life approximately 12 months)

  • Store reconstituted protein at -20°C/-80°C (shelf life approximately 6 months)

  • Keep working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles

What assays can be used to measure P. denitrificans NDK activity?

While specific assays for P. denitrificans NDK are not detailed in the search results, standard enzymatic assays can be adapted based on methodologies used for other bacterial NDKs:

• Coupled enzyme assay: This approach links NDK activity to pyruvate kinase and lactate dehydrogenase reactions, enabling spectrophotometric monitoring of NADH oxidation.

• Direct phosphate transfer assay: Measuring the transfer of radioactively labeled phosphate from [γ-32P]ATP to various NDPs.

• HPLC analysis: Quantification of nucleotide conversion through high-performance liquid chromatography.

• Substrate specificity analysis: Comparative analysis of phosphate transfer rates to different NDPs to determine substrate preferences, particularly between cytosolic and membrane fractions.

Based on P. aeruginosa research, it may be valuable to separately analyze cytosolic and membrane fractions, as they may display different substrate preferences .

How can researchers investigate NDK subcellular localization in P. denitrificans?

Research on P. aeruginosa has demonstrated that NDK exists in both cytosolic and membrane-associated forms with different catalytic properties . To investigate similar distribution in P. denitrificans, researchers can employ:

• Subcellular fractionation:

  • Differential centrifugation to separate cytosolic and membrane fractions

  • Western blotting using anti-NDK antibodies to determine relative distribution

  • Activity assays of each fraction to compare catalytic properties

• Immunolocalization techniques:

  • Immunogold electron microscopy to visualize NDK distribution at high resolution

  • Fluorescence microscopy with labeled antibodies or fluorescent protein fusions

• Membrane association studies:

  • Analysis of potential membrane-binding domains

  • Lipid interaction assays to determine if P. denitrificans NDK directly interacts with membrane components

How might NDK function interact with P. denitrificans' denitrification pathways?

P. denitrificans is a model organism for denitrification studies, capable of using nitrate as an electron acceptor for anaerobic respiration and reducing it to dinitrogen via nitrite, nitric oxide, and nitrous oxide . While direct evidence linking NDK to denitrification is lacking in the search results, several potential interactions can be hypothesized:

• Energy metabolism support: Denitrification requires precise regulation of electron transport and energy generation. NDK may help maintain balanced nucleotide energy carriers essential for this process.

• Regulatory crosstalk: The denitrification pathway in P. denitrificans is regulated by several factors including RegAB, DksA, and ppGpp . GTP generated by NDK could participate in signaling cascades that regulate expression of denitrification enzymes.

• Adaptation to different carbon sources: Expression of the periplasmic nitrate reductase (NAP) is elevated when P. denitrificans grows on reduced carbon sources like butyrate . NDK may play a role in metabolic adaptations required for growth on different carbon sources.

What is known about NDK protein-protein interactions in bacterial systems?

Studies in P. aeruginosa have revealed that NDK forms a complex with pyruvate kinase, which significantly alters NDK's substrate specificity toward GTP formation . This interaction represents an important regulatory mechanism linking central carbon metabolism with nucleotide homeostasis.

For P. denitrificans specifically, potential interaction partners might include:

• Metabolic enzymes: Interactions with glycolytic or TCA cycle enzymes could coordinate central metabolism with nucleotide synthesis.

• Respiratory complexes: Associations with components of the electron transport chain might regulate energy production during transitions between respiratory modes.

• Regulatory proteins: Interactions with regulatory factors like DksA or components of the RegAB system might integrate nucleotide metabolism with adaptive responses.

Experimental approaches to investigate these interactions could include co-immunoprecipitation, bacterial two-hybrid assays, or proximity-dependent labeling techniques.

How can NDK be used as a tool to study energy metabolism in P. denitrificans?

NDK's central role in nucleotide metabolism makes it valuable for investigating energy homeostasis in P. denitrificans under different growth conditions:

• Metabolic flux analysis: NDK activity can serve as a readout for changes in nucleotide flux during transitions between aerobic and anaerobic metabolism.

• Redox homeostasis studies: As P. denitrificans adjusts to growth on reduced carbon sources, NDK activity may reflect mechanisms for maintaining redox balance.

• Genetic reporter systems: NDK promoter-reporter fusions can help monitor changes in NDK expression under different metabolic states.

• Comparative studies: Analysis of NDK activity in different P. denitrificans strains (wild-type vs. regulatory mutants) can provide insights into how nucleotide metabolism integrates with respiratory adaptation.

What approaches can be used to investigate potential roles of NDK in bacterial stress responses?

While the search results don't explicitly connect NDK to stress responses in P. denitrificans, research could explore:

• Gene expression analysis:

  • qRT-PCR to measure NDK transcript levels under various stress conditions

  • Promoter fusion studies to identify regulatory elements responsive to stress

• Mutant phenotyping:

  • Construction of NDK-deficient strains

  • Comparative growth analysis under various stressors (oxidative stress, nitrosative stress, nutrient limitation)

  • Complementation studies with wild-type and mutant NDK variants

• Metabolomic approaches:

  • Nucleotide profiling in wild-type vs. NDK-deficient strains under stress

  • Metabolic flux analysis to track changes in nucleotide distribution

• Integration with known stress response pathways:

  • Investigate potential connections between NDK and the stringent response mediated by ppGpp and DksA

  • Examine interactions with oxidative stress response systems

How does P. denitrificans NDK compare with NDKs from other bacterial species?

Based on available information about P. aeruginosa NDK and the sequence data for P. denitrificans NDK , the following comparative analysis can be provided:

Further experimental work would be needed to fully characterize these differences and their functional implications.

What insights about denitrification could be gained through comparative analysis of NDK function across different denitrifying bacteria?

Comparative analysis of NDK across different denitrifying bacteria could reveal:

• Metabolic adaptations: How NDK function has evolved to support different denitrification strategies

• Regulatory integration: Variations in how NDK activity is coordinated with denitrification pathways

• Energy conservation mechanisms: Different strategies for balancing nucleotide pools during anaerobic respiration

• Specialized functions: Whether NDK has acquired additional roles in denitrifying bacteria compared to non-denitrifying relatives

Such comparative work would be particularly valuable given that P. denitrificans serves as an important model for understanding denitrification, which has significant environmental implications as a route for loss of fixed nitrogen from soil and as a source of the greenhouse gas nitrous oxide .

What are the major challenges in studying P. denitrificans NDK function?

Current challenges include:

• Limited direct research: Few studies have specifically characterized NDK from P. denitrificans, requiring extrapolation from research on related organisms.

• Functional redundancy: Multiple enzymes may catalyze phosphotransfer reactions, complicating interpretation of knockout studies.

• Subcellular complexity: Different pools of NDK may have distinct functions based on localization, requiring careful fractionation approaches.

• Integration with regulatory networks: Understanding how NDK function interfaces with complex regulatory systems like DksA/ppGpp and RegAB that control denitrification .

What emerging technologies might advance our understanding of NDK function in P. denitrificans?

Promising technologies include:

• CRISPR-Cas9 gene editing: For precise manipulation of NDK and related genes

• Cryo-EM structural analysis: To determine high-resolution structures of P. denitrificans NDK in different functional states

• Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics to develop comprehensive models of NDK's role in cellular metabolism

• Single-molecule enzymology: To characterize the kinetic properties of NDK at unprecedented resolution

• Systems biology approaches: To model how NDK integrates with broader metabolic and regulatory networks, particularly in the context of respiratory transitions that are central to P. denitrificans' ecological role

How can researchers troubleshoot issues with recombinant P. denitrificans NDK activity?

When facing challenges with recombinant NDK activity, consider these approaches:

• Protein quality assessment:

  • Verify protein integrity via SDS-PAGE (should show >85% purity)

  • Confirm correct molecular weight (expected ~15 kDa based on 138 amino acid length)

  • Check for potential proteolytic degradation

• Buffer optimization:

  • Test different pH ranges (typically pH 7.0-8.5)

  • Evaluate different divalent cations (Mg²⁺, Mn²⁺) at various concentrations

  • Consider including stabilizing agents like glycerol (5-50%)

• Storage conditions:

  • Ensure proper storage at recommended temperatures

  • Minimize freeze-thaw cycles

  • Consider adding protease inhibitors if degradation is observed

• Activity assay conditions:

  • Optimize substrate concentrations

  • Verify assay components with positive control (commercial NDK)

  • Include proper negative controls (heat-inactivated enzyme)

What controls are essential when studying NDK activity in experimental systems?

Critical controls include:

• Enzyme controls:

  • Heat-inactivated enzyme (negative control)

  • Commercial NDK (positive control)

  • Reaction without substrate (background control)

• Substrate specificity controls:

  • Test multiple NDP substrates to establish specificity profile

  • Compare activity with different NTP donors (ATP, GTP, CTP, UTP)

• Subcellular fraction controls:

  • If studying membrane vs. cytosolic fractions, include markers to verify fractionation purity

  • Compare activities in different fractions to identify compartment-specific behaviors

• Inhibition controls:

  • Include EDTA control to demonstrate metal dependence

  • Test non-hydrolyzable ATP analogs to confirm specificity

These controls help ensure experimental rigor and facilitate troubleshooting if unexpected results are observed.