Recombinant Paracoccus denitrificans UPF0060 membrane protein Pden_1837 (Pden_1837)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Paracoccus denitrificans UPF0060 membrane protein Pden_1837 (Pden_1837) is a protein that, in its full-length form, consists of 111 amino acids . It is expressed in E. coli with an N-terminal His tag .

Paracoccus denitrificans as a Model Organism

Paracoccus denitrificans is a metabolically versatile bacterium found in soil, demonstrating a remarkable capacity to adapt to different environmental conditions . Its metabolic flexibility makes it a valuable subject for proteomic research, particularly in understanding membrane protein expression under various growth conditions . P. denitrificans is closely related to the protomitochondrion and shares similarities with the contemporary mitochondrial chain, setting it apart from other bacterial species . It utilizes ubiquinone-10, like the human respiratory chain, and its Complex I exhibits higher sequence similarity to mammalian complexes .

Role in Denitrification

Paracoccus denitrificans is capable of performing complete denitrification, a process where nitrate is reduced to nitrogen gas . This involves several reductases, including nitrate reductase, nitrite reductase, nitric oxide reductase, and nitrous oxide reductase, coupled to the electron transport pathway .

Paracoccus denitrificans Complex I

Paracoccus denitrificans is a suitable bacterial model for studying mitochondrial complex I . Researchers have developed purification protocols to isolate highly active complex I by introducing a His 6-tag on the Nqo5 subunit and optimizing the reconstitution of the enzyme into liposomes to demonstrate its proton pumping activity . Additionally, a P. denitrificans strain amenable to complex I mutagenesis has been created to study the enzyme's catalytic mechanism .

Genome-Scale Metabolic Model

A genome-scale metabolic model of Paracoccus denitrificans has been constructed, encompassing 972 metabolic genes, 1,371 reactions, and 1,388 unique metabolites . This model facilitates quantitative predictions of biomass yields on various carbon sources under aerobic conditions and accurately predicts yields on acetate, formate, and succinate when NO3− is used as an electron acceptor .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
Pden_1837; UPF0060 membrane protein Pden_1837
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Paracoccus denitrificans (strain Pd 1222)
Target Names
Pden_1837
Target Protein Sequence
MTLAAPIAVYVLAALAEIAGCFAFWAWLRLGKSPLWLVPGMVSLAVFAWLLTRVDADFAG RAYAAYGGIYVTASLGWLWLTEGQVPTRWDILGGGLCVLGAMVILAGPRAA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Pden_1837?

E. coli has been successfully employed as an expression host for Pden_1837. When expressing this membrane protein, consider the following protocol:

  • Clone the Pden_1837 gene into an expression vector with an N-terminal His-tag for purification

  • Transform into an E. coli strain optimized for membrane protein expression (such as C41(DE3) or C43(DE3))

  • Grow cells at lower temperatures (16-25°C) after induction to reduce inclusion body formation

  • Use 0.1-0.5 mM IPTG for induction to avoid overwhelming the membrane insertion machinery

This approach has been demonstrated to yield functional protein as evidenced by successful purification of His-tagged Pden_1837 from E. coli systems .

What purification methods yield the highest purity of recombinant Pden_1837?

A two-step purification protocol is recommended:

Step 1: Affinity Chromatography

  • Solubilize membranes with n-dodecyl β-D-maltoside (DDM)

  • Load onto Ni-NTA column

  • Wash with buffer containing low imidazole (20-40 mM)

  • Elute with 200 mM imidazole

Step 2: Size Exclusion Chromatography

  • Apply eluate to size exclusion column

  • Collect fractions corresponding to the expected molecular weight

  • Verify purity using SDS-PAGE (should exceed 90%)

This approach is adapted from successful purification strategies used for other membrane proteins from P. denitrificans . Always supplement buffers with 0.02% asolectin to maintain protein stability during purification .

How should recombinant Pden_1837 be reconstituted after lyophilization?

For optimal reconstitution of lyophilized Pden_1837:

  • Centrifuge the vial briefly to bring all contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

These conditions have been demonstrated to maintain protein integrity and activity post-reconstitution .

How can I design experimental controls when investigating Pden_1837 function?

When designing experiments to study Pden_1837 function, implement a robust experimental design following these principles:

Control Types to Include:

  • Positive Control: Wild-type Pden_1837 with confirmed activity

  • Negative Control: Expression system without Pden_1837 gene

  • Internal Control: A well-characterized membrane protein from the same organism

  • Methodological Control: Alternative purification method to confirm activity is not an artifact

Based on Campbell and Stanley's experimental design framework , consider implementing a pretest-posttest control group design:

GroupPre-measurementTreatmentPost-measurement
ExperimentalBaseline activityPden_1837Activity after addition
Control 1Baseline activityNo proteinActivity after same time
Control 2Baseline activityDenatured Pden_1837Activity after addition

This design controls for history, maturation, testing, and instrumentation threats to validity, ensuring that observed effects can be attributed to Pden_1837 function .

How do wild-type and recombinant forms of P. denitrificans proteins differ in enzymatic activity?

Studies comparing wild-type and recombinant proteins from P. denitrificans have revealed significant differences in enzymatic activities. For instance, research on cytochrome c oxidase showed a remarkable 20-fold difference in catalase activity between true wild-type and recombinant wild-type enzymes .

Potential Causes for Activity Differences:

  • Altered metal ion coordination in recombinant systems

  • Differences in post-translational modifications

  • Chaperone availability affecting proper folding

  • Subtle structural variations affecting active site geometry

When working with Pden_1837, it's crucial to compare your recombinant protein's activity with native protein when possible. If discrepancies are observed, consider co-expressing chaperones specific to P. denitrificans to improve proper folding. One approach demonstrated with cytochrome c oxidase was to clone genes for chaperones (ctaG and surf1c) on the same plasmid as the target protein gene, which resulted in enzymatic activity more closely resembling the wild-type protein .

What methods are effective for studying Pden_1837 integration into artificial membrane systems?

For functional studies of Pden_1837 in artificial membrane systems:

Liposome Reconstitution Protocol:

  • Prepare liposomes from a mixture of phosphatidylcholine and phosphatidylethanolamine (7:3 ratio)

  • Solubilize liposomes with detergent (0.5% Triton X-100)

  • Add purified Pden_1837 at a lipid-to-protein ratio of 50:1

  • Remove detergent using Bio-Beads SM-2 or dialysis

  • Confirm reconstitution by freeze-fracture electron microscopy or dynamic light scattering

This approach has been successfully applied to other membrane proteins from P. denitrificans, including complex I components . For functional assays, consider incorporating fluorescent probes sensitive to membrane potential or ion gradients to monitor Pden_1837 activity in real-time.

How can mutation analysis be designed to investigate structure-function relationships in Pden_1837?

To systematically investigate structure-function relationships in Pden_1837:

  • Identify Conserved Residues: Perform multiple sequence alignment of UPF0060 family proteins to identify highly conserved residues

  • Predict Functional Domains: Use bioinformatics tools to predict transmembrane regions and potential functional sites

  • Design Mutation Strategy:

    • Alanine scanning of conserved residues

    • Conservative substitutions to test chemical requirements

    • Non-conservative substitutions to test structural tolerance

Mutation Implementation Protocol:

  • Use site-directed mutagenesis with the QuikChange method

  • Confirm mutations by sequencing

  • Express and purify mutant proteins using identical conditions to wild-type

  • Compare biochemical properties and functional activities

Drawing from established protocols for P. denitrificans genetic manipulation , introduce unmarked mutations into the chromosomal DNA by suicide vector-mediated homologous recombination. This method has been successfully applied to other membrane proteins in P. denitrificans .

What analytical methods can resolve contradictory data in Pden_1837 functional studies?

When facing contradictory results in Pden_1837 functional studies, employ the following analytical approach:

  • Identify Variables: Systematically catalog all experimental variables that differ between contradictory studies

  • Control Experiments: Design experiments that isolate one variable at a time

  • Statistical Analysis: Apply appropriate statistical methods to determine significance

Multiple Time-Series Design:
Implement a multiple time-series experimental design as described by Campbell and Stanley to track changes in Pden_1837 activity under different conditions over time:

ConditionTime 1Time 2TreatmentTime 3Time 4Time 5
Group AO1O2X1O3O4O5
Group BO6O7X2O8O9O10

This design allows detection of both immediate and delayed effects, helping to resolve contradictions that might be time-dependent. For thermal stability contradictions, employ differential scanning calorimetry to compare thermal profiles of various Pden_1837 preparations, as this technique has successfully resolved stability differences in aged versus fresh preparations of P. denitrificans proteins .

How can I design experiments to investigate Pden_1837's role within the context of P. denitrificans as a model for mitochondrial processes?

P. denitrificans serves as an excellent model for mitochondrial processes due to its close evolutionary relationship to the protomitochondrion . To investigate Pden_1837's potential role in these processes:

  • Comparative Analysis: Compare Pden_1837 sequence with mitochondrial proteins from various organisms

  • Genetic Approach: Create knockout mutants of Pden_1837 and assess respiratory chain function

  • Protein Interaction Studies: Use pull-down assays with tagged Pden_1837 to identify interaction partners

Experimental Design Strategy:
Implement a quasi-experimental design approach with the following elements:

  • Generate a Pden_1837 knockout strain

  • Compare respiratory parameters with wild-type under various conditions:

    • Aerobic growth

    • Anaerobic growth with nitrate

    • Growth under nutrient limitation

    • Growth under oxidative stress

  • Measure key parameters including:

    • Oxygen consumption rates

    • Membrane potential

    • ATP synthesis

    • Superoxide production

This approach leverages P. denitrificans' similarity to mitochondrial systems, including its use of ubiquinone-10 (the same as human respiratory chains) and its ability to form respiratory supercomplexes . The genetic tractability of P. denitrificans makes it an ideal system for such functional studies, allowing insights that might be applicable to understanding mitochondrial membrane protein functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.