Recombinant Paracoccus pantotrophus Putative dicarboxylate transporter subunit (dctM)

Shipped with Ice Packs
In Stock

Description

Biological Role and Functional Context

The dctM gene encodes a membrane-bound subunit of the TRAP transporter system, which operates in conjunction with two other subunits:

  • dctP: A periplasmic solute-binding protein that captures dicarboxylates .

  • dctQ: A transmembrane subunit facilitating substrate translocation .

This system enables high-affinity uptake of dicarboxylates in Paracoccus pantotrophus, supporting its metabolic flexibility in nutrient-scarce environments . Experimental mutagenesis studies in Rhodobacter capsulatus (a close relative) confirmed that all three subunits (dctP, dctQ, dctM) are essential for functional transport .

Recombinant Expression

  • Expression System: Optimized in E. coli for high yield .

  • Purity: >90% as confirmed by SDS-PAGE .

  • Applications:

    • Study of TRAP transporter mechanisms .

    • Metabolic engineering of bacteria for bioremediation (e.g., degrading PET plastics) .

    • Structural analysis of membrane protein complexes .

Research Findings

  • Genetic Studies: In Rhodobacter capsulatus, deletion of dctM abolished dicarboxylate transport, confirming its indispensability .

  • Evolutionary Conservation: Homologs of dctM exist in diverse Gram-negative bacteria, including E. coli and Bordetella pertussis, highlighting its functional importance .

  • Biotechnological Potential: Engineered P. pantotrophus strains expressing dctM show enhanced growth on terephthalic acid, a monomer of polyethylene terephthalate (PET) .

Taxonomic and Genomic Context

  • Species: Paracoccus pantotrophus (formerly Thiosphaera pantotropha) .

  • Genome: Contains two circular chromosomes and plasmids, with extensive metabolic gene clusters .

  • Ecological Role: Sulfur-oxidizing chemoautotroph found in marine sediments and wastewater .

Future Directions

  • Structural Resolution: High-resolution crystallography to elucidate substrate-binding dynamics.

  • Industrial Use: Optimizing dctM-expressing strains for large-scale biodegradation of environmental pollutants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will strive to fulfill your needs.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dctM; Putative dicarboxylate transporter subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Paracoccus pantotrophus (Thiosphaera pantotropha)
Target Names
dctM
Target Protein Sequence
ALLLIVLIVGGIRGGVFTPTEASVVAVFYAIVTSAFVYRGFTLADLWGAFLRSAIMSVAV LMILAAARAFAWVLIIEGVPQMADAVIAMDLSPIAFLLMVNLLLLVFGMFMDPLPGVMIL VPILAPFATARIARDHFAIIVIVNLTFGLMTPPVGGLIFVVPRDPAEPSALIREQPPFFL AAMASLLILTFVPALSTWLPQISFAR
Uniprot No.

Target Background

Protein Families
YiaN/YgiK family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Paracoccus pantotrophus and why is it valuable as a research organism?

Paracoccus pantotrophus DSM 2944 is a Gram-negative bacterium belonging to the phylum Alphaproteobacteria and the family Rhodobacteraceae. It has gained significant attention in synthetic biology research due to its remarkable metabolic versatility and physiological robustness. This organism possesses several valuable characteristics including high salt tolerance (>10% NaCl), good thermotolerance (up to 45°C), and the ability to utilize diverse substrates such as C1 compounds (formate), C2 compounds (ethylene glycol), organic acids, alcohols, and short-chain alkanes . Additionally, P. pantotrophus can synthesize biodegradable polymers like polyhydroxybutyrate, positioning it as a promising candidate for advancing principles of circular bioeconomy . Unlike some other laboratory strains, P. pantotrophus is not classified as an opportunistic human pathogen, making it safer for laboratory use .

What is the dicarboxylate transporter subunit (dctM) and what function does it serve in bacterial metabolism?

The dicarboxylate transporter subunit (dctM) is a critical component of the TRAP (Tripartite ATP-independent Periplasmic) transport system in bacteria. TRAP transporters typically consist of three components: a periplasmic solute-binding protein (DctP), a small membrane protein (DctQ), and a large membrane protein (DctM). The DctM subunit functions as the main transmembrane component of the transporter complex, forming a channel through which dicarboxylates such as succinate, malate, and fumarate can pass. The transport process is ATP-independent and instead relies on an electrochemical ion gradient (usually Na+ or H+) for energy.

In metabolically versatile organisms like P. pantotrophus, the dctM-containing transport system plays a crucial role in the uptake of C4-dicarboxylates, which can serve as both carbon and energy sources. This transport capability contributes significantly to the organism's metabolic flexibility, allowing it to utilize a wider range of substrates for growth and survival in diverse environments.

How can researchers effectively clone and express the dctM gene from P. pantotrophus?

Effective cloning and expression of the dctM gene from P. pantotrophus requires careful consideration of several factors based on the genetic tools developed for this organism. The following methodological approach is recommended:

  • Gene isolation strategy:

    • Amplify the dctM gene using PCR with high-fidelity polymerase

    • Design primers with appropriate restriction sites for subsequent cloning

    • Consider including the native operon structure if dctM functions as part of a complex

  • Vector selection:

    • Use plasmids with the RK2 origin of replication, which shows highest compatibility with P. pantotrophus

    • Include appropriate antibiotic resistance markers (kanamycin at >25 mg/L, chloramphenicol at >5 mg/L, or ampicillin, tetracycline, or spectinomycin)

  • Introduction method:

    • Employ bacterial conjugation as the preferred method for introducing the construct into P. pantotrophus

    • Use a helper plasmid (such as pRK600) to enhance conjugation efficiency by 100-fold

    • Consider streptomycin (50 mg/L) as a counter-selective marker against donor E. coli strains

  • Expression optimization:

    • Select an appropriate promoter system from the array of synthetic promoters tested in P. pantotrophus

    • Consider codon optimization based on P. pantotrophus codon usage preferences

    • For membrane proteins like DctM, lower expression temperatures (25-30°C) may improve proper folding

This methodology leverages the genetic toolbox specifically developed for P. pantotrophus DSM 2944, increasing the likelihood of successful dctM cloning and expression.

What antibiotic selection markers are effective for P. pantotrophus genetic engineering?

The antibiotic resistance profile of P. pantotrophus DSM 2944 has been systematically characterized, providing crucial information for selecting appropriate antibiotics for genetic engineering applications. The following table summarizes the resistance profile and recommendations for application:

AntibioticResistance LevelRecommended Application
StreptomycinVery high (resistant to 250 mg/L)Effective counter-selection against other bacteria (50 mg/L)
GentamycinVery high (resistant to 200 mg/L)Counter-selection against other bacteria
KanamycinModerate (MIC at 25 mg/L)Selection marker at >25 mg/L (typically 50 mg/L)
ChloramphenicolLow (MIC at 5 mg/L)Selection marker at >5 mg/L
AmpicillinNone (sensitive at all tested concentrations)Excellent selection marker
TetracyclineNone (sensitive at all tested concentrations)Excellent selection marker
SpectinomycinNone (sensitive at all tested concentrations)Excellent selection marker

For optimal genetic engineering of P. pantotrophus, a dual selection strategy is recommended: using kanamycin (50 mg/L) as a selective marker and streptomycin (50 mg/L) as a counter-selective marker for one-step selection of transconjugants . This approach effectively eliminates the growth of both non-transformed P. pantotrophus and donor E. coli strains, simplifying the identification of recombinant clones.

Which origins of replication are compatible with P. pantotrophus and how does this impact vector design?

Origin of ReplicationCopy NumberCompatibility with P. pantotrophus
RK2LowHighest (most transformants)
pRO1600/ColE1HighLow (few colonies)
RFS1010-Low (few colonies)
R6K-None (no transformants)
pBBR1-None (no transformants)
p15A-None (no transformants)
pSC101-None (no transformants)
pUC-None (no transformants)
pBR322/ROP-None (no transformants)

Based on these findings, the low copy number, broad host range ori RK2 is most compatible with P. pantotrophus DSM 2944 and is recommended for replicative plasmids designed for this organism . High copy number plasmids showed lower compatibility, likely due to the metabolic burden they impose on the host. For genome editing applications requiring suicide vectors, origins such as R6K that failed to produce transformants are ideal candidates .

These results provide essential guidance for designing expression vectors for recombinant dctM studies in P. pantotrophus, highlighting the importance of using RK2-based plasmids for stable expression.

What are the most efficient methods for introducing recombinant dctM constructs into P. pantotrophus?

Three different methods for introducing foreign DNA into P. pantotrophus DSM 2944 have been evaluated, with varying degrees of success:

MethodEfficiencyKey Observations
Chemical TransformationNo colonies obtainedStandard protocols for Gram-negative bacteria are not suitable
ElectroporationSuccessful but limited efficiencySuccessfully transformed with plasmids conferring resistance to kanamycin and spectinomycin
ConjugationHighest efficiencyMost effective method; efficiency enhanced 100-fold with helper plasmid pRK600

Conjugation clearly emerges as the most efficient method for introducing recombinant constructs, including dctM-containing plasmids, into P. pantotrophus DSM 2944 . The use of a helper plasmid (pRK600) significantly enhances conjugation efficiency, increasing the number of transconjugants by approximately 100-fold compared to conjugation without a helper plasmid .

For optimal results when introducing dctM constructs into P. pantotrophus, the following conjugation protocol is recommended:

  • Use donor E. coli strains containing both the dctM construct and a helper plasmid

  • Mix donor E. coli with recipient P. pantotrophus cells at an appropriate ratio

  • Incubate the mixture on non-selective media to allow conjugation

  • Plate on selective media containing appropriate antibiotics (e.g., kanamycin at 50 mg/L for selection of transconjugants and streptomycin at 50 mg/L for counter-selection against E. coli)

  • Incubate at 37°C for 48 hours to obtain transconjugants

This optimized conjugation protocol provides the most reliable method for introducing recombinant dctM constructs into P. pantotrophus.

How can expression of the dctM gene be optimized in P. pantotrophus?

Optimizing expression of the dctM gene in P. pantotrophus requires a multifaceted approach addressing several key factors:

  • Promoter selection and regulation:

    • Test multiple promoters from the standardized array of synthetic promoters developed for P. pantotrophus

    • Consider inducible promoter systems for controlled expression

    • Evaluate both constitutive and regulated expression strategies

  • Codon and sequence optimization:

    • Adjust the codons in the dctM gene to match the codon usage bias of P. pantotrophus

    • Optimize the ribosome binding site (RBS) sequence and spacing

    • Remove potential mRNA secondary structures that could impede translation

  • Vector backbone optimization:

    • Use plasmids with the RK2 origin of replication, which shows highest compatibility with P. pantotrophus

    • Evaluate plasmid stability under non-selective conditions

    • Balance plasmid copy number with expression requirements

  • Expression conditions:

    • Leverage P. pantotrophus's thermotolerance (up to 45°C) to test different growth temperatures

    • For membrane proteins like DctM, lower temperatures during expression may improve proper folding

    • Optimize media composition based on P. pantotrophus's ability to utilize diverse carbon sources

  • Co-expression strategies:

    • Consider expressing dctM as part of its native operon with dctP and dctQ

    • Co-express molecular chaperones to assist in proper protein folding

    • Evaluate fusion tags that might enhance stability or folding

  • Cellular localization:

    • Ensure proper targeting to the membrane through retention of native signal sequences

    • Consider the impact of N- or C-terminal tags on membrane insertion

By systematically optimizing these factors, researchers can enhance the expression of functional dctM in P. pantotrophus, maximizing the yield of properly folded and active transporter protein.

What experimental approaches can be used to study the function of the dctM protein?

Several robust experimental approaches can be employed to characterize the function of the DctM protein in P. pantotrophus:

These experimental approaches leverage the genetic toolbox developed for P. pantotrophus DSM 2944, enabling comprehensive functional characterization of the DctM protein.

How can mutations in the dctM gene be created and analyzed in P. pantotrophus?

The genetic tools developed for P. pantotrophus DSM 2944 provide several approaches for creating and analyzing mutations in the dctM gene:

  • Targeted mutagenesis strategies:

    a) Site-directed mutagenesis on plasmid-borne dctM:

    • Design primers containing specific mutations

    • Perform PCR-based mutagenesis on a plasmid containing dctM

    • Verify mutations by sequencing

    • Introduce mutated constructs into P. pantotrophus via conjugation

    b) Genomic modifications using pEMG-based system:

    • The pEMG-based scarless gene deletion technique has been successfully applied in P. pantotrophus with a 98% success rate

    • This system uses I-SceI recognition sites flanking homologous regions

    • Create mutated versions of dctM and integrate them into the genome

    • The suicide vector with R6K origin is effective for this purpose

  • Random mutagenesis approaches:

    • Error-prone PCR to generate a library of dctM variants

    • In vivo mutagenesis using mutator strains

    • Screen for altered transport phenotypes

  • Analysis of mutants:

    a) Functional complementation:

    • Express mutated versions of dctM in a ΔdctM background

    • Compare the ability of different variants to restore dicarboxylate transport

    b) Transport assays:

    • Quantify dicarboxylate uptake rates in strains expressing different dctM variants

    • Determine kinetic parameters for different substrates

    • Identify mutations that alter substrate specificity or transport efficiency

    c) Growth phenotypes:

    • Compare growth rates and yields on different dicarboxylates

    • Assess growth under various environmental conditions

    d) Protein expression and localization:

    • Examine membrane localization of mutant proteins

    • Assess protein stability and expression levels

  • Adaptive laboratory evolution:

    • The search results mention successful adaptive laboratory evolution experiments with P. pantotrophus

    • This approach can select for beneficial mutations in dctM that enhance transport function

    • Whole genome sequencing can identify mutations that arise during adaptation

These methodologies allow for comprehensive mutational analysis of the dctM gene, providing insights into structure-function relationships and identifying residues critical for transport activity.

How can the dctM gene be engineered to enhance bioremediation applications with P. pantotrophus?

P. pantotrophus possesses intrinsic capabilities that make it promising for bioremediation applications, including its ability to consume short-chain alkanes, utilize diverse carbon sources, and tolerate extreme conditions (high salt, high temperature) . The dctM gene can be engineered to further enhance these capabilities:

  • Enhanced substrate uptake:

    • Modify the substrate binding site to recognize specific environmental pollutants

    • Increase affinity for target compounds through directed evolution

    • Optimize expression levels to maximize transport capacity

  • Integration with degradation pathways:

    • The successful integration of a terephthalic acid degradation gene cassette in P. pantotrophus demonstrates the feasibility of this approach

    • Engineer dctM as part of synthetic operons containing genes for complete degradation pathways

    • Create optimized transport-degradation modules for specific pollutants

  • Strain optimization strategies:

    • Employ adaptive laboratory evolution (demonstrated successful in P. pantotrophus) to improve growth on target compounds

    • The engineered strain developed for PET monomer utilization showed increased growth rates after adaptation

    • Apply metabolic engineering to balance transport with metabolic capacity

  • Field application considerations:

    • Leverage P. pantotrophus's tolerance to extreme conditions (high salt >10%, temperatures up to 45°C) for diverse environmental applications

    • Engineer strains for specific environmental niches

    • Develop immobilization strategies to enhance stability in field applications

  • Case study: Engineering for plastic degradation

    • The search results describe successful engineering of P. pantotrophus to grow on both monomers of polyethylene terephthalate (PET)

    • This approach combined gene cassette integration with adaptive laboratory evolution

    • Similar strategies could be applied for other pollutants, with dctM engineering enhancing substrate uptake

By leveraging the genetic toolbox developed for P. pantotrophus DSM 2944, researchers can engineer dctM-based transport systems tailored to specific bioremediation applications, enhancing the organism's natural metabolic versatility and environmental tolerance.

What role does the dctM protein play in the metabolic versatility of P. pantotrophus?

The dctM protein likely plays a significant role in the remarkable metabolic versatility of P. pantotrophus DSM 2944, though specific details aren't explicitly covered in the search results. Based on the known functions of dicarboxylate transporters and the metabolic capabilities of P. pantotrophus, we can infer several important contributions:

  • Carbon source utilization:

    • The DctM protein, as part of the TRAP transport system, enables uptake of C4-dicarboxylates

    • These compounds can serve as both carbon and energy sources

    • This transport capability expands the range of substrates P. pantotrophus can utilize, contributing to its documented metabolic versatility

  • Integration with central metabolism:

    • Dicarboxylates are key intermediates in the TCA cycle

    • Efficient transport of these compounds can replenish TCA cycle intermediates

    • This anaplerotic function supports growth on other carbon sources, including the C1 and C2 compounds that P. pantotrophus can utilize

  • Support for specialized metabolism:

    • P. pantotrophus can synthesize polyhydroxybutyrate, a biodegradable biopolymer

    • Dicarboxylates can serve as precursors for PHA biosynthesis

    • The DctM transporter may therefore support this specialized metabolic capability

  • Adaptation to diverse environments:

    • P. pantotrophus demonstrates tolerance to extreme conditions (high salinity >10% NaCl, temperatures up to 45°C)

    • Efficient nutrient uptake systems are essential for adaptation to diverse environments

    • DctM may contribute to the organism's ability to thrive under various conditions by ensuring access to available carbon sources

  • Potential role in PET monomer utilization:

    • The search results describe engineering P. pantotrophus to grow on terephthalic acid, a monomer of PET

    • Dicarboxylate transporters might play a role in the uptake of terephthalic acid, which has structural similarities to dicarboxylates

Understanding the specific contribution of DctM to P. pantotrophus metabolism would require experimental approaches such as gene deletion and metabolic flux analysis. The genetic tools described in the search results provide a foundation for such studies.

How can structural biology approaches be applied to study the dctM protein?

Structural biology approaches can provide valuable insights into the function and mechanism of the DctM protein, though they present unique challenges due to its nature as a membrane protein. Several methodological strategies can be applied:

  • Expression and purification optimization:

    • Develop specialized expression systems in P. pantotrophus using the genetic tools described

    • Create fusion constructs with tags that enhance stability and purification

    • Optimize detergent selection for extraction from the membrane

    • Consider nanodiscs or other membrane mimetics for stabilization

  • Structural determination techniques:

    a) X-ray crystallography:

    • Optimize crystallization conditions for membrane proteins

    • Consider lipidic cubic phase crystallization

    • Use surface entropy reduction mutations to enhance crystallization

    b) Cryo-electron microscopy (cryo-EM):

    • Particularly suitable for membrane proteins in their native environment

    • Can resolve structures without crystallization

    • May capture different conformational states of the transporter

    c) Nuclear magnetic resonance (NMR) spectroscopy:

    • Suitable for analyzing specific domains or interactions

    • Can provide dynamic information about the transport mechanism

  • Computational approaches:

    • Homology modeling based on related transporters

    • Molecular dynamics simulations to study conformational changes

    • Docking studies to examine substrate binding

  • Functional validation of structural insights:

    • Site-directed mutagenesis of residues identified through structural studies

    • The pEMG-based gene modification system in P. pantotrophus enables creation of point mutations

    • Correlate structural features with transport activity

  • Structure-guided engineering:

    • Modify substrate specificity based on structural insights

    • Engineer improved transport properties

    • Design inhibitors or activators for mechanistic studies

These structural biology approaches, combined with the genetic tools developed for P. pantotrophus DSM 2944, would enable comprehensive structure-function analysis of the DctM protein, providing insights into its transport mechanism and potential applications in biotechnology.

What are common challenges in expressing recombinant dctM in P. pantotrophus and how can they be addressed?

Expressing recombinant membrane proteins like dctM presents several challenges. Based on the information about P. pantotrophus DSM 2944 as an expression host, researchers might encounter the following issues and can apply these solutions:

  • Low transformation efficiency:

    • Challenge: The search results indicate that chemical transformation was unsuccessful for P. pantotrophus, and electroporation showed limited efficiency .

    • Solution: Utilize conjugation with a helper plasmid (e.g., pRK600), which increased efficiency 100-fold in studies with P. pantotrophus .

  • Antibiotic selection issues:

    • Challenge: P. pantotrophus has varying levels of intrinsic resistance to different antibiotics .

    • Solution: Use antibiotics to which P. pantotrophus is sensitive (ampicillin, tetracycline, spectinomycin) or higher concentrations of those with moderate resistance (kanamycin >25 mg/L) .

  • Plasmid instability:

    • Challenge: Maintaining stable plasmid expression without selection pressure.

    • Solution: Use the RK2 origin of replication, which showed highest compatibility with P. pantotrophus , and monitor plasmid retention through regular testing.

  • Membrane protein folding issues:

    • Challenge: Membrane proteins often misfold when overexpressed.

    • Solution: Lower expression temperature (utilizing P. pantotrophus's growth range), reduce expression rate with weaker promoters, co-express chaperones, or express dctM as part of its native operon with dctP and dctQ.

  • Toxicity from overexpression:

    • Challenge: Overexpression of membrane proteins can disrupt membrane integrity.

    • Solution: Use inducible promoter systems, balance expression levels, or employ adaptive laboratory evolution (already demonstrated successful with P. pantotrophus) to select for variants with improved tolerance.

  • Functional validation difficulties:

    • Challenge: Confirming that recombinant DctM is properly folded and functional.

    • Solution: Develop transport assays, create reporter systems, or use complementation of a ΔdctM mutant created using the pEMG-based deletion system .

By addressing these challenges using the genetic tools specifically developed for P. pantotrophus DSM 2944, researchers can improve the expression of functional recombinant dctM protein.

How can researchers validate the function of expressed dctM protein?

Validating the function of expressed dctM protein requires multiple complementary approaches that assess both expression and activity:

  • Expression validation:

    a) Protein detection:

    • Western blotting with antibodies against DctM or an epitope tag

    • Mass spectrometry-based proteomics to confirm protein identity

    • Fluorescent tagging to visualize expression and localization

    b) Subcellular localization:

    • Membrane fractionation to confirm presence in the membrane fraction

    • Immunofluorescence microscopy to visualize membrane localization

    • Surface labeling techniques for accessibility studies

  • Functional validation:

    a) Genetic complementation:

    • Create a dctM knockout mutant using the pEMG-based scarless gene deletion system successfully applied in P. pantotrophus

    • Complement with plasmid-expressed dctM

    • Assess restoration of growth on dicarboxylates as sole carbon sources

    b) Transport assays:

    • Direct measurement of dicarboxylate uptake using radiolabeled substrates

    • Compare uptake kinetics between wild-type, knockout, and complemented strains

    • Evaluate substrate specificity and ion dependence

    c) Growth phenotype analysis:

    • Compare growth rates on dicarboxylates

    • Assess competitive fitness under relevant conditions

    • Measure adaptation to different carbon sources

  • Structural integrity assessment:

    • Circular dichroism to assess secondary structure content

    • Limited proteolysis to evaluate folding state

    • Thermal stability assays to assess protein quality

  • Interaction studies:

    • Co-immunoprecipitation to confirm interactions with DctP and DctQ components

    • Blue native PAGE to visualize intact transporter complexes

    • Crosslinking studies to capture transient interactions

  • Advanced functional characterization:

    • Reconstitution into proteoliposomes for controlled transport studies

    • Electrophysiological methods to measure transport activity

    • Substrate binding assays to assess affinity and specificity

These validation approaches provide complementary information about expression, localization, and function, enabling comprehensive characterization of recombinant DctM protein in P. pantotrophus.

What approaches can overcome inclusion body formation when expressing dctM?

Membrane proteins like DctM are prone to inclusion body formation when overexpressed. Several strategies can be employed to overcome this challenge in P. pantotrophus:

  • Expression condition optimization:

    • Temperature modulation: Exploit P. pantotrophus's thermotolerance (up to 45°C) by testing a range of lower temperatures (25-30°C) during induction to slow folding and membrane insertion

    • Growth phase optimization: Induce expression during exponential phase when membrane synthesis is most active

    • Media composition: Test minimal versus rich media to identify optimal conditions

  • Expression level tuning:

    • Promoter selection: Test different promoters from the array of synthetic promoters developed for P. pantotrophus

    • Induction strategy: If using inducible promoters, optimize inducer concentration and timing

    • Vector copy number: Use the RK2 origin with its low copy number to prevent overwhelming the membrane insertion machinery

  • Co-expression strategies:

    • Chaperone co-expression: Introduce molecular chaperones to assist protein folding

    • Partner protein co-expression: Express DctM together with its native partners DctP and DctQ

    • Fusion partners: Test fusion with solubility-enhancing protein tags

  • Genetic optimization:

    • Codon optimization: Adjust codon usage to match P. pantotrophus preferences

    • Sequence modifications: Remove potential aggregation-prone regions

    • Signal sequence optimization: Ensure proper membrane targeting

  • Adaptive laboratory evolution:

    • The search results mention successful adaptive laboratory evolution experiments with P. pantotrophus

    • Apply this approach to select for variants that better tolerate DctM expression

    • Identify beneficial host mutations that improve membrane protein expression

  • Extraction and refolding strategies:

    • If inclusion bodies still form, optimize conditions for solubilization

    • Test different detergents for extraction of functional protein

    • Develop refolding protocols specific for DctM

By combining these approaches and systematically optimizing conditions, researchers can minimize inclusion body formation and maximize the yield of properly folded and functional DctM protein in P. pantotrophus DSM 2944.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.