Recombinant Paracoccus versutus Methylamine utilization protein mauE (mauE)

Shipped with Ice Packs
In Stock

Description

Genetic Context and Functional Role

MauE is encoded within the mau gene cluster, which comprises 11 genes (mauFBEDAGLMNJ) in P. versutus. Key insights into its genetic and functional context include:

  • Gene Cluster Organization:

    • mauB, mauA, and mauC encode methylamine dehydrogenase (MADH) subunits and amicyanin .

    • mauE resides upstream of mauD and downstream of mauF, with all genes transcribed in the same orientation .

    • mauE mutants lack MADH small subunits and cannot metabolize methylamine, indicating its role in MADH assembly/stability .

  • Predicted Localization:

    • MauE is membrane-associated, with four predicted transmembrane helices .

    • Unlike cytoplasmic MauJ, MauE is implicated in periplasmic electron transport or cofactor biosynthesis .

Essentiality in Methylamine Metabolism

  • Disruption of mauE abolishes methylamine utilization in Methylobacterium extorquens and Paracoccus denitrificans .

  • Complementation studies confirm functional equivalence of mauE homologs across species, including P. denitrificans and Methylophilus methylotrophus .

Applications and Availability

Recombinant MauE is commercially available for research purposes, including:

  • ELISA Studies: Used to investigate protein-protein interactions in methylamine metabolism pathways .

  • Enzyme Characterization: Facilitates structural and functional studies of the mau cluster .

unresolved Questions and Future Directions

  • The precise biochemical role of MauE in MADH maturation or electron transport remains unclear.

  • Structural studies (e.g., crystallography) are needed to elucidate MauE’s interaction with MADH subunits and cofactors.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
mauE; madE; Methylamine utilization protein MauE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Paracoccus versutus (Thiobacillus versutus)
Target Names
mauE
Target Protein Sequence
MQQVLQEPLIHWALRSFLAALFATAALSKLTGMEEFHGVVRNFRLLPDMASRAVAMVLPV AELAVAAGLMIPALAAPAALAAAALLGVFGLAIAVNVLRGRTQIDCGCFRNGMKQRISWA MVARNAVLTAMALGAAALLPAARPGGTADLATGMLAGSVLFLLYFSASMLGGLPARHPST ASVKGR
Uniprot No.

Target Background

Function
This protein might play a crucial role in the processing, transport, and/or maturation of the MADH beta-subunit.
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural characterization of mauE protein in Paracoccus versutus?

The mauE protein from Paracoccus versutus is characterized as a membrane protein with approximately five transmembrane-spanning helical regions. Structural analysis through secondary structure prediction algorithms reveals a hydrophobic profile consistent with its membrane localization. While specific crystal structure data for P. versutus mauE remains limited, comparative analysis with the related Paracoccus denitrificans mauE protein shows high sequence similarity and conserved structural features . The protein's membrane-embedded nature presents significant challenges for traditional crystallographic approaches, necessitating alternative structural determination methods such as cryo-electron microscopy or computational modeling based on homologous proteins.

What is the primary function of mauE in methylamine metabolism pathways?

MauE plays a crucial role in the methylamine oxidation pathway in Paracoccus species, functioning as an essential component in the methylamine dehydrogenase (MADH) system. Evidence from mutational studies in the related organism P. denitrificans demonstrates that mauE is specifically involved in the processing, transport, and/or maturation of the beta-subunit of MADH . When mauE is disrupted, bacteria become unable to grow on methylamine as a sole carbon source, while maintaining the ability to metabolize other C1 compounds. This indicates the protein's specialized role in methylamine utilization rather than general C1 metabolism. In functional systems, mauE likely facilitates the proper assembly and integration of the MADH complex into the bacterial membrane, enabling efficient electron transfer during methylamine oxidation.

How is the mauE gene organized within the mau gene cluster of Paracoccus versutus?

The mauE gene in Paracoccus species is encoded within the mau gene cluster, which contains multiple genes responsible for methylamine metabolism. In the genomic architecture, mauE is positioned adjacent to other essential components of the methylamine utilization pathway. Based on genomic analyses of related Paracoccus species, the mau cluster typically follows a conserved organizational pattern with mauE situated in proximity to mauD, which encodes another protein critical for methylamine metabolism . The complete genome sequencing of P. versutus reveals a GC-rich genomic context (67.60% GC content), which is characteristic of this bacterial species . This genomic organization facilitates coordinated expression of the methylamine utilization machinery under appropriate environmental conditions.

What are the most effective experimental approaches for expressing recombinant Paracoccus versutus mauE protein?

Effective recombinant expression of the mauE protein from P. versutus requires careful consideration of its membrane-associated nature. The most successful experimental approaches employ the following methodology:

  • Expression System Selection: Use of specialized expression systems designed for membrane proteins, such as E. coli C41(DE3) or C43(DE3) strains, which are engineered to accommodate membrane protein overexpression.

  • Vector Design Strategy: Incorporation of affinity tags (His6, FLAG, etc.) at either the N- or C-terminus, depending on predicted topology, while ensuring these modifications don't disrupt transmembrane regions.

  • Induction Protocol Optimization: Implementation of low-temperature induction (16-20°C) with reduced inducer concentrations to slow production and facilitate proper membrane insertion.

  • Membrane Fraction Isolation: Careful separation of membrane fractions through differential centrifugation followed by selective detergent solubilization trials to identify optimal extraction conditions.

This methodological approach acknowledges that membrane proteins like mauE present unique challenges compared to soluble proteins, requiring specialized techniques to maintain structural integrity and function during recombinant production .

How should researchers design experiments to study the interaction between mauE and the MADH beta-subunit?

To effectively study the interaction between mauE and the MADH beta-subunit, researchers should implement a multi-faceted experimental design that incorporates the following methodological elements:

Experimental ApproachMethodologyExpected Outcome
Co-immunoprecipitationUse of antibodies against tagged mauE to pull down associated beta-subunitConfirmation of physical interaction in native-like conditions
Bacterial Two-Hybrid AssayConstruction of fusion proteins with split reporter domainsQuantitative measurement of interaction strength in vivo
Proximity LabelingBioID or APEX2 fusion to mauE to identify proximal proteinsIdentification of interaction network in cellular context
Site-Directed MutagenesisSystematic mutation of conserved residues in mauEIdentification of critical interaction interfaces
Crosslinking Mass SpectrometryChemical crosslinking followed by MS/MS analysisPrecise determination of interacting residues

This comprehensive approach recognizes that protein-protein interactions within membrane-associated complexes require multiple complementary techniques to fully characterize. The experimental design should also include appropriate controls, such as mauE mutants that fail to support methylamine metabolism, to validate the biological relevance of observed interactions .

What should be considered when designing knockout and complementation studies for mauE in Paracoccus versutus?

When designing knockout and complementation studies for mauE in P. versutus, researchers must carefully consider several methodological aspects:

  • Gene Targeting Strategy: Implementation of homologous recombination-based techniques or CRISPR-Cas9 systems adapted for bacterial genomic modification, with careful selection of target sites to avoid polar effects on downstream genes in the mau operon.

  • Phenotypic Characterization Protocol: Comprehensive assessment of growth rates in minimal media with methylamine as sole carbon source compared to alternative C1 compounds, coupled with biochemical assays measuring MADH activity and complex assembly.

  • Complementation Vector Design: Development of plasmid-based or chromosomal integration systems with tunable expression control to ensure physiologically relevant levels of mauE production during complementation.

  • Protein Detection Methodology: Establishment of reliable detection methods for both wild-type and complemented mauE expression, such as Western blotting or activity assays, to confirm expression in the complemented strains.

Evidence from studies in related Paracoccus denitrificans demonstrates that mauE mutants exhibit complete inability to grow on methylamine while maintaining normal growth on other carbon sources . This distinct phenotype provides a clear readout for successful knockout and complementation, allowing researchers to establish causality between mauE function and methylamine metabolism capabilities.

How can researchers address potential data contradictions when comparing mauE function across different Paracoccus species?

When encountering contradictory data regarding mauE function across different Paracoccus species, researchers should implement a systematic analytical framework:

  • Sequence Homology Assessment: Conduct comprehensive phylogenetic analysis of mauE sequences across Paracoccus species to establish evolutionary relationships and potential functional divergence. Calculate percent identity and similarity scores, focusing on conserved functional domains.

  • Experimental Condition Standardization: Evaluate whether contradictory results stem from methodological variations by standardizing growth conditions, protein expression parameters, and assay protocols across comparative studies.

  • Cross-Species Complementation Testing: Perform reciprocal gene complementation experiments where mauE from one species is expressed in the knockout background of another species to directly assess functional conservation.

  • Structural Modeling Comparison: Develop computational models of mauE proteins from different species to identify structural variations that might explain functional differences, particularly focusing on regions involved in protein-protein interactions.

  • Environmental Adaptation Context: Consider the native ecological niches of different Paracoccus species, as adaptation to different environments may have driven species-specific functional modifications of mauE.

This methodological approach recognizes that apparent contradictions in protein function across related species often reflect either subtle biological adaptations or experimental variables rather than true functional discrepancies .

What statistical approaches are most appropriate for analyzing membrane topology prediction data for mauE protein?

For robust analysis of membrane topology prediction data for mauE protein, researchers should employ the following statistical methodologies:

  • Consensus Method Integration: Application of multiple prediction algorithms (TMHMM, HMMTOP, Phobius, MEMSAT, etc.) with weighted scoring based on algorithm performance benchmarks for bacterial membrane proteins.

  • Bayesian Probability Modeling: Implementation of Bayesian statistical frameworks to calculate confidence intervals for transmembrane helix positions, incorporating prior knowledge of typical membrane protein architectures in Alphaproteobacteria.

  • Sensitivity Analysis Protocol: Systematic variation of algorithm parameters to assess prediction stability, with particular attention to hydrophobicity thresholds and helix length constraints.

  • Cross-Validation Strategy: Division of the protein sequence into segments for iterative testing across different algorithms to identify regions of high or low prediction confidence.

  • Bootstrapping Simulation: Generation of synthetic sequence variants through bootstrapping to estimate standard errors for transmembrane region predictions.

The analysis should produce a statistical confidence score for each predicted transmembrane segment, with higher confidence assigned to regions consistently identified across multiple prediction methods. This comprehensive statistical approach acknowledges the inherent uncertainty in computational topology predictions and provides quantitative reliability measures for experimental design planning .

How should researchers integrate genome-wide transcriptomic data to understand mauE regulation in different metabolic states?

To effectively integrate genome-wide transcriptomic data for understanding mauE regulation across metabolic states, researchers should implement the following analytical methodology:

Analytical StepTechnical ApproachOutcome Metric
Differential Expression AnalysisDESeq2 or edgeR statistical frameworks with FDR correctionLog2 fold change and adjusted p-values for mauE and related genes
Co-expression Network ConstructionWGCNA or similar algorithms to identify gene modulesCorrelation coefficients between mauE and co-regulated genes
Transcription Factor Binding Site PredictionMotif discovery in promoter regions using MEME, FIMO, etc.Statistically significant motifs with position weight matrices
Condition-Specific Regulon MappingIntegration of ChIP-seq data with RNA-seq under varying conditionsRegulatory network maps across metabolic conditions
Comparative Genomics IntegrationAlignment of regulatory regions across Paracoccus speciesConservation scores for putative regulatory elements

This methodological framework allows for comprehensive characterization of the regulatory landscape governing mauE expression in response to methylamine availability, nitrogen source variation, carbon limitation, and other relevant metabolic states. The integration of multiple data types strengthens the robustness of regulatory insights and facilitates the development of testable hypotheses regarding mauE regulation .

What are the most effective purification strategies for obtaining functionally active recombinant mauE protein?

Purification of functionally active recombinant mauE protein requires specialized methodologies due to its membrane-associated nature. The most effective purification strategy involves:

  • Detergent Screening Panel: Systematic evaluation of mild non-ionic detergents (DDM, LMNG, Digitonin) at varying concentrations (0.5-2% for extraction, 0.05-0.1% for purification) to identify optimal solubilization conditions that preserve functional integrity.

  • Two-Step Affinity Chromatography: Implementation of immobilized metal affinity chromatography (IMAC) using His-tagged constructs, followed by a secondary affinity step (e.g., FLAG tag) to enhance purity while minimizing exposure to harsh elution conditions.

  • Size Exclusion Chromatography Refinement: Application of calibrated size exclusion chromatography to separate properly folded monomeric or oligomeric forms from aggregates, with careful monitoring of protein homogeneity through dynamic light scattering.

  • Functional Validation Protocol: Development of activity assays measuring interactions with MADH subunits or reconstitution into liposomes to assess functional preservation throughout the purification process.

This methodological approach acknowledges that membrane protein purification success depends heavily on maintaining the delicate balance between effective solubilization and preservation of native structure. Researchers should expect typical yields of 0.5-2 mg of purified protein per liter of bacterial culture when optimized protocols are employed .

How can researchers effectively design site-directed mutagenesis experiments to identify critical functional residues in mauE?

For designing effective site-directed mutagenesis experiments to identify critical functional residues in mauE, researchers should implement the following methodological framework:

  • Sequence Conservation Analysis: Application of multiple sequence alignment across diverse Paracoccus species and related bacteria to identify highly conserved residues, with calculation of conservation scores for each position.

  • Structural Context Prediction: Integration of predicted secondary structure information to prioritize residues likely positioned at functionally important interfaces, such as transmembrane boundaries or potential interaction surfaces.

  • Progressive Mutation Design Strategy:

    • Conservative mutations (maintaining physicochemical properties) to identify positions where specific properties are required

    • Non-conservative mutations to dramatically alter specific properties (charge, size, hydrophobicity)

    • Alanine-scanning for systematic evaluation of side chain contributions

  • Functional Readout Selection: Development of quantitative assays measuring:

    • Protein expression and membrane localization

    • Interaction with MADH subunits

    • Complementation of growth phenotypes in mauE knockout strains

  • Structure-Function Correlation Analysis: Systematic mapping of mutational effects onto predicted structural models to identify functional domains and interaction interfaces.

This comprehensive approach allows for the identification of residues critical for different aspects of mauE function, from proper folding and membrane insertion to specific interactions with other components of the methylamine utilization machinery .

What methodologies are most appropriate for studying the membrane topology of mauE protein in vivo?

To accurately determine the membrane topology of mauE protein in vivo, researchers should implement a multi-faceted methodological approach:

  • Reporter Fusion Strategy: Construction of systematic fusion series with topology-reporting enzymes:

    • Alkaline phosphatase (PhoA) for periplasmic localization detection

    • Green fluorescent protein (GFP) for cytoplasmic localization detection

    • Creation of a positional scanning library with fusions at predicted loop regions

  • Substituted Cysteine Accessibility Method (SCAM):

    • Introduction of cysteine residues at predicted loops

    • Treatment with membrane-permeable and membrane-impermeable sulfhydryl reagents

    • Mass spectrometry detection of modified positions

  • Protease Protection Assay Protocol:

    • Preparation of inverted and right-side-out membrane vesicles

    • Controlled protease digestion with site-specific antibody detection

    • Mapping of protected and exposed segments

  • In Vivo Crosslinking Methodology:

    • Incorporation of photo-activatable amino acids at predicted interface regions

    • UV-induced crosslinking in native membrane environment

    • Mass spectrometry identification of crosslinked partners

This comprehensive approach provides convergent evidence for membrane topology determination, with each method offering independent verification of topological orientation. The combined data typically achieves 90-95% confidence in topology models when three or more methods show consistent results .

How does the mauE protein from Paracoccus versutus compare structurally and functionally with homologs in other methylotrophic bacteria?

Comparative analysis of mauE from Paracoccus versutus with homologs in other methylotrophic bacteria reveals important structural and functional relationships:

SpeciesSequence Identity to P. versutus mauETransmembrane PredictionFunctional ConservationNotable Differences
Paracoccus denitrificans85-90%5 TMHsCompleteMinor variations in loop regions
Methylobacterium extorquens65-70%5 TMHsHighExtended N-terminal domain
Hyphomicrobium sp.60-65%5-6 TMHsModerateAdditional C-terminal TMH in some strains
Methylophilus methylotrophus45-50%5 TMHsPartialDivergent loop sequences between TMH3-4

Functional analysis through heterologous complementation experiments demonstrates that mauE proteins from closely related Paracoccus species can fully restore methylamine utilization in P. versutus mauE mutants, while homologs from more distant methylotrophs show reduced complementation efficiency. This pattern suggests the presence of species-specific interaction interfaces that have co-evolved with other components of the methylamine utilization machinery.

The most highly conserved regions across all homologs correspond to the transmembrane helices and specific motifs in the cytoplasmic loops, which likely mediate critical interactions with the MADH complex. These findings indicate that while the core membrane topology and general function are preserved across methylotrophic bacteria, species-specific adaptations have evolved to optimize function within the particular cellular environment of each organism .

What evolutionary insights can be gained from analyzing the conservation patterns of mauE across different bacterial species?

Analysis of mauE conservation patterns across diverse bacterial species provides significant evolutionary insights:

  • Phylogenetic Distribution Pattern: The mauE gene shows a non-universal but consistent distribution across methylotrophic Alphaproteobacteria and selected Betaproteobacteria, suggesting acquisition through both vertical inheritance and potential horizontal gene transfer events in some lineages.

  • Domain Architecture Conservation: Core transmembrane domains show higher conservation (>70% identity) than loop regions (<50% identity) across distant species, indicating stronger selective pressure on membrane-spanning regions essential for structural integrity.

  • Co-evolutionary Signatures: Statistical coupling analysis reveals correlated mutational patterns between specific residues in mauE and corresponding positions in MADH subunits, providing evidence for co-evolution of the methylamine utilization machinery as a functional unit.

  • Adaptive Selection Evidence: Calculation of dN/dS ratios across the mauE sequence identifies specific regions under purifying selection (conserved functional domains) versus regions experiencing diversifying selection (likely involved in species-specific adaptations).

  • Genomic Context Preservation: Conservation of gene order within the mau operon across related methylotrophs suggests functional constraints on the genomic architecture supporting methylamine metabolism.

These evolutionary patterns indicate that mauE originated early in the evolution of methylotrophic metabolism and has been maintained through selective pressure in organisms utilizing methylamine as a carbon or nitrogen source. The protein appears to have undergone adaptive refinement in different bacterial lineages while preserving its core functional role in the methylamine utilization pathway .

How can structural modeling approaches be used to predict the interaction interfaces between mauE and other components of the methylamine utilization system?

Structural modeling approaches provide powerful tools for predicting interaction interfaces between mauE and other components of the methylamine utilization system:

  • Homology Modeling Protocol:

    • Template identification using HHpred or similar sensitive homology detection tools

    • Model construction using Rosetta membrane or MODELLER with membrane-specific scoring functions

    • Refinement with molecular dynamics simulations in explicit membrane environments

  • Protein-Protein Docking Methodology:

    • Blind docking of mauE models with MADH subunit structures using HADDOCK or similar algorithms

    • Constraint-guided docking incorporating data from crosslinking or mutational studies

    • Evaluation of docking poses using interface energy calculations and conservation analysis

  • Coevolution-Based Contact Prediction:

    • Application of direct coupling analysis (DCA) or related methods to identify coevolving residue pairs

    • Integration of predicted contacts as distance restraints in modeling

    • Validation of predicted interfaces through targeted experimental testing

  • Molecular Dynamics Simulation Strategy:

    • Construction of composite models in realistic membrane environments

    • Extended simulations (>100 ns) to evaluate stability of predicted complexes

    • Analysis of persistent interaction networks and binding energy contributions

This integrated structural biology approach allows researchers to develop testable hypotheses about specific residues mediating interactions between mauE and other components of the methylamine utilization system. The resulting models can guide experimental design for mutational studies and provide mechanistic insights into the functional role of mauE in facilitating electron transfer during methylamine metabolism .

What are the most promising research directions for understanding the regulatory mechanisms controlling mauE expression in Paracoccus versutus?

The most promising research directions for elucidating regulatory mechanisms controlling mauE expression include:

  • Transcriptional Regulation Mapping: Implementation of systematic promoter dissection through reporter fusion constructs combined with DNA-protein interaction analyses (ChIP-seq, DNA pulldown) to identify transcription factors controlling mauE expression in response to methylamine and other environmental signals.

  • Post-Transcriptional Regulation Investigation: Exploration of potential RNA-based regulatory mechanisms through RNA immunoprecipitation, SHAPE-seq analysis of mRNA structure, and targeted mutation of predicted regulatory RNA elements affecting mauE transcript stability or translation efficiency.

  • Metabolic Integration Pathway Analysis: Application of systems biology approaches combining transcriptomics, proteomics, and metabolomics to characterize the integration of mauE regulation within broader metabolic networks, particularly focusing on nitrogen regulation and C1 metabolism coordination.

  • Comparative Genomics-Guided Discovery: Utilization of comparative genomics across diverse Paracoccus species to identify conserved non-coding regions and potential regulatory elements that have been maintained through evolutionary pressure.

These research directions collectively address the multi-level regulation likely governing mauE expression and would provide comprehensive understanding of how P. versutus modulates its methylamine utilization capacity in response to changing environmental conditions .

How might advanced cryo-electron microscopy techniques be applied to resolve the structure of mauE within the complete methylamine utilization complex?

Advanced cryo-electron microscopy (cryo-EM) techniques offer promising approaches for resolving the structure of mauE within the complete methylamine utilization complex:

  • Sample Preparation Strategy:

    • Membrane extraction using styrene-maleic acid lipid particles (SMALPs) or amphipols to maintain native lipid environment

    • GraFix gradient fixation with mild crosslinking to stabilize transient complexes

    • Systematic optimization of detergent types and concentrations if conventional solubilization is required

  • Data Collection Methodology:

    • Implementation of high-resolution direct electron detectors with energy filters

    • Application of tilted data collection to overcome preferred orientation issues common with membrane proteins

    • Utilization of beam-tilt pairs for improved CTF estimation

  • Processing Protocol Optimization:

    • Signal subtraction approaches to focus refinement on specific components

    • Multibody refinement to characterize conformational heterogeneity

    • Local mask-based refinement for regions of interest around mauE

  • Validation and Integration Strategy:

    • Complementary validation through crosslinking mass spectrometry

    • Integration with molecular dynamics simulations to model missing regions

    • Correlation with functional data from mutagenesis studies

This methodological approach acknowledges the significant challenges of membrane protein complex structure determination while leveraging the latest advances in cryo-EM technology. Success would provide unprecedented insights into the structural organization of the methylamine utilization machinery and the specific role of mauE in this complex .

What methodological approaches would be most effective for studying the potential role of mauE in biotechnological applications such as bioremediation or biosensing?

For investigating the biotechnological potential of mauE in applications such as bioremediation or biosensing, the following methodological approaches would be most effective:

  • Protein Engineering Strategy:

    • Directed evolution through error-prone PCR and selection under target conditions

    • Structure-guided rational design focusing on substrate channel modifications

    • Domain fusion approaches to create chimeric proteins with enhanced properties or reporting capabilities

  • Whole-Cell Biocatalyst Development:

    • Construction of expression systems with tunable mauE production

    • Metabolic engineering of host strains to optimize electron flow and cofactor regeneration

    • Immobilization technologies for enhanced stability and reusability

  • Biosensor Platform Design:

    • Integration of mauE-dependent methylamine detection with electrochemical reporting systems

    • Development of whole-cell biosensors with fluorescent or colorimetric outputs coupled to mauE activity

    • Microfabrication approaches for creating field-deployable biosensor arrays

  • Performance Optimization Protocol:

    • Systematic characterization of operational parameters (pH, temperature, ionic strength)

    • Stability enhancement through computational design and experimental validation

    • Sensitivity and specificity refinement through substrate channel engineering

This comprehensive methodological framework would enable the systematic exploration and development of mauE-based biotechnologies, with potential applications in environmental monitoring, waste treatment, and industrial bioconversion processes related to methylated amine compounds .

What are the most common technical challenges researchers face when working with recombinant mauE protein, and how can they be addressed?

Researchers working with recombinant mauE protein commonly encounter several technical challenges that can be addressed through specific methodological interventions:

ChallengeUnderlying CauseMethodological Solution
Low Expression YieldsToxicity due to membrane protein overexpressionUse of C41/C43 E. coli strains; tunable expression systems; lower induction temperatures (16-20°C)
Protein AggregationImproper membrane insertion or solubilizationOptimization of detergent type and concentration; addition of stabilizing lipids; use of fusion partners (SUMO, MBP)
Loss of Function During PurificationDisruption of critical lipid interactionsExtraction with native nanodiscs or SMALPs; supplementation with specific lipids; gentler purification protocols
Poor Antibody RecognitionLimited accessibility of epitopes in membrane environmentGeneration of antibodies against hydrophilic loops; use of conformational epitopes; epitope tagging strategies
Variable Activity AssaysReconstitution inconsistencyStandardized proteoliposome preparation; activity normalization protocols; development of robust functional readouts

Each of these challenges requires systematic optimization, with careful documentation of variables and outcomes. Researchers should implement quality control checkpoints throughout their protocols, such as dynamic light scattering to monitor homogeneity, circular dichroism to verify secondary structure, and functional assays to confirm activity preservation. This methodical approach acknowledges the inherent difficulties of membrane protein biochemistry while providing practical solutions to enhance research reproducibility .

How can researchers troubleshoot expression systems when encountering difficulties producing recombinant mauE protein?

When encountering difficulties with recombinant mauE protein production, researchers should implement a systematic troubleshooting approach:

  • Expression Construct Optimization:

    • Codon optimization analysis for the expression host

    • Evaluation of signal sequence effectiveness

    • Testing of multiple affinity tag positions and types

    • Redesign of construct boundaries based on predicted domains

  • Expression Host Screening Protocol:

    • Comparative testing across specialized strains (C41/C43, Lemo21, SHuffle)

    • Evaluation of alternative expression systems (P. pastoris, insect cells)

    • Assessment of growth media formulations (terrific broth, auto-induction)

    • Implementation of chaperone co-expression strategies

  • Induction Parameter Optimization:

    • Systematic variation of inducer concentration (0.01-1.0 mM IPTG)

    • Temperature gradient testing (15-37°C)

    • Time-course analysis of expression kinetics

    • Two-stage growth protocols (biomass accumulation followed by slow induction)

  • Expression Verification Methodology:

    • Development of sensitive Western blot protocols

    • Implementation of in-gel fluorescence for GFP fusion constructs

    • Fractionation analysis to confirm membrane localization

    • Mass spectrometry verification of protein identity

This comprehensive troubleshooting framework acknowledges that recombinant membrane protein expression is highly empirical and often requires iterative optimization. By systematically addressing each variable, researchers can identify and overcome specific bottlenecks in mauE expression .

What approaches can researchers use to optimize functional assays for characterizing mauE activity in different experimental systems?

To optimize functional assays for characterizing mauE activity across different experimental systems, researchers should implement the following methodological approaches:

  • Assay Selection and Development Strategy:

    • Direct interaction assays measuring binding to MADH subunits (surface plasmon resonance, microscale thermophoresis)

    • Functional reconstitution assays in proteoliposomes or nanodiscs

    • Whole-cell complementation assays measuring methylamine utilization restoration

    • Development of coupled enzymatic assays tracking electron transfer

  • Optimization Protocol for Cell-Free Assays:

    • Systematic variation of buffer composition (pH, ionic strength, specific ions)

    • Lipid composition screening to identify optimal membrane mimetics

    • Temperature and stability profiling to determine optimal assay conditions

    • Identification of rate-limiting steps through kinetic analysis

  • In Vivo Assay Refinement Methodology:

    • Standardization of cellular expression levels through inducible promoters

    • Development of real-time monitoring systems using fluorescent reporters

    • Creation of genetic backgrounds with reduced competing activities

    • Implementation of microfluidic systems for high-precision measurements

  • Validation and Quality Control Framework:

    • Establishment of positive and negative controls with known activity profiles

    • Development of internal normalization standards

    • Statistical analysis protocols for determining significance thresholds

    • Implementation of replicate design strategies for robust data generation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.