Recombinant Paracottus kneri Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Paracottus knerii (Stone sculpin) (Cottus knerii)
Target Names
rho
Target Protein Sequence
YLVSPAAYAALGAYMFLLILVGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVRKPISNFRFT EDHAIMGLGFSWVMASTCAVPPLVGWLRYIPEGMQCSCGVDYYTRAEGFNTESFVLYMFT VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVIMVIGYLVCWLPYA SVAWWIFCNQGSEFGPIFMTLPAFFAKTSAIYNPLIYICMNKQFRHCMI
Uniprot No.

Target Background

Function
Photoreceptor essential for image-forming vision under low light conditions. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish employ 3-dehydroretinal or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, effectively terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Paracottus kneri Rhodopsin and why is it significant for research?

Paracottus kneri Rhodopsin (rho) is a visual pigment protein expressed in the stone sculpin (Paracottus knerii), a cottoid fish species endemic to Russia, primarily found in Lake Baikal and surrounding tributaries. This protein serves as the primary photoreceptor in the rod cells of the fish's retina, enabling vision in low-light conditions .

The significance of this protein for research stems from several factors. First, it represents an adaptive visual system that has evolved in response to the specific light environment of Lake Baikal. Studies have shown that cottoid fish living in Lake Baikal demonstrate visual pigments with wavelength absorption maxima (λmax) that shift toward shorter wavelengths (blue-shift) with increasing habitat depth . This makes Paracottus kneri Rhodopsin an excellent model for studying how visual systems adapt to specific ecological niches.

Additionally, the stone sculpin is the only recognized species in the monotypic genus Paracottus, making its rhodopsin a unique subject for comparative visual pigment research . By studying the structural and functional properties of this protein, researchers can gain insights into the molecular mechanisms underlying visual adaptation in aquatic environments and contribute to our broader understanding of sensory evolution.

How does Paracottus kneri Rhodopsin compare to rhodopsins from other species?

When comparing Paracottus kneri Rhodopsin to rhodopsins from other species, several important distinctions and similarities emerge:

Evolutionary Context:
The stone sculpin (Paracottus knerii) belongs to the family Cottidae, subfamily Cottinae, and was first described as Cottus knerii in 1874 by the Polish zoologist Benedykt Dybowski before being reclassified to the genus Paracottus by Dmitrii Nikolaevich Taliev in 1949 . This taxonomic history places its rhodopsin within the broader context of cottoid fish visual pigments, which have undergone adaptive radiation in Lake Baikal.

Spectral Properties:
A distinctive feature of cottoid fish visual pigments in Lake Baikal, including those of Paracottus kneri, is the short-wave shifting of absorption maxima (λmax) with increasing habitat depth . This pattern differs from some shallow-water fish rhodopsins and represents an adaptation to the blue-shifted light environment of deeper waters. The stone sculpin inhabits depths from shallow water to 50 meters (occasionally to 100 meters), suggesting its rhodopsin may have evolved to function effectively across a range of light conditions .

Structural Adaptations:
Research on cottoid fish from Lake Baikal has identified three potential spectral tuning sites (positions 118, 215, and 269) that influence wavelength sensitivity . These specific amino acid positions may differ from those in other species, reflecting the unique evolutionary pressures of the Lake Baikal environment.

Unlike some fish species that underwent genome duplication (such as goldfish, which exhibit duplicate opsin genes that are both expressed) , the stone sculpin appears to have a single rhodopsin gene. This difference in gene copy number may affect how the visual system has evolved and adapted in this species compared to tetraploid fishes.

What are the recommended protocols for handling recombinant Paracottus kneri Rhodopsin?

Proper handling of recombinant Paracottus kneri Rhodopsin is critical for maintaining protein integrity and experimental reproducibility. Based on available information, the following protocols are recommended:

Storage and Stability:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • For extended storage, maintain at -20°C or -80°C

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as these can damage protein structure

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

Buffer Conditions:
The recombinant protein is typically supplied in one of the following buffers:

  • Tris-based buffer with 50% glycerol, optimized for protein stability

  • Tris/PBS-based buffer containing 6% trehalose at pH 8.0

These buffers are designed to maintain protein stability and function. For applications requiring different buffer conditions, a careful buffer exchange procedure should be implemented to avoid protein denaturation.

Quality Control Considerations:

  • Purity is typically greater than 90% as determined by SDS-PAGE

  • Verify protein integrity via SDS-PAGE before experimental use

  • For functional studies, confirm proper folding and chromophore binding capability

Following these guidelines will help ensure the integrity and functionality of the recombinant protein for research applications.

How can spectral tuning sites in Paracottus kneri Rhodopsin be experimentally analyzed?

The analysis of spectral tuning sites in Paracottus kneri Rhodopsin requires a systematic approach combining molecular biology techniques, heterologous expression, and spectroscopic analysis. Based on research conducted with cottoid fish visual pigments, the following experimental strategy is recommended:

Identification of Potential Tuning Sites:
Research on the blue opsin of cottoid fish from Lake Baikal has identified three potential spectral tuning sites at positions 118, 215, and 269 . These positions, or their equivalents in rhodopsin, would be primary targets for mutational analysis.

Site-Directed Mutagenesis Protocol:

  • Design of Mutagenic Oligonucleotides:

    • Create primers that introduce specific amino acid substitutions at target positions

    • Include appropriate restriction sites for screening if applicable

  • Mutagenesis Methods:
    Available techniques include:

    • Promega Altered Sites® II system

    • Stratagene QuikChange™ system

  • Verification of Mutations:

    • Confirm successful mutagenesis by DNA sequencing

    • Ensure no additional mutations were introduced

Heterologous Expression:

  • Expression System Selection:

    • 293T mammalian cells have been successfully used for cottoid fish visual pigments

    • E. coli systems may be used with appropriate optimization for membrane proteins

  • Protein Production:

    • Transform/transfect host cells with wild-type and mutant constructs

    • Optimize expression conditions (temperature, induction time, etc.)

    • Extract and purify the recombinant proteins

  • Chromophore Regeneration:

    • Reconstitute the purified opsins with 11-cis retinal

    • Verify successful regeneration by preliminary spectroscopic analysis

Spectroscopic Analysis:

  • Absorption Spectroscopy:

    • Measure the absorption spectra of wild-type and mutant proteins

    • Determine the wavelength of maximum absorption (λmax) for each variant

    • Calculate spectral shifts induced by specific mutations

  • Data Analysis:

    • Compare λmax values across mutants

    • Correlate amino acid properties with spectral shifts

    • Develop a structure-function model relating sequence to spectral properties

This methodological approach can systematically identify how specific amino acid substitutions affect the spectral properties of Paracottus kneri Rhodopsin, providing insights into the molecular mechanisms of visual adaptation in this species.

What methods are recommended for studying the evolutionary context of Paracottus kneri Rhodopsin?

Studying the evolutionary context of Paracottus kneri Rhodopsin requires an integrated approach combining molecular phylogenetics, comparative genomics, and functional analysis. The following methodological framework is recommended:

Phylogenetic Analysis:

  • Sequence Acquisition:

    • Amplify and sequence the rhodopsin gene from Paracottus kneri and related cottoid species

    • Include representatives from different depths in Lake Baikal

    • Incorporate sequences from public databases for broader taxonomic sampling

  • Sequence Alignment:

    • Align coding sequences using algorithms appropriate for protein-coding genes

    • Verify alignments manually to ensure homology of compared sites

    • Consider codon-based alignments for subsequent selection analyses

  • Tree Construction:

    • Implement maximum likelihood and Bayesian inference methods

    • Select appropriate evolutionary models based on likelihood ratio tests

    • Assess node support through bootstrap or posterior probability values

  • Ancestral State Reconstruction:

    • Infer ancestral rhodopsin sequences at key nodes

    • Estimate the timing and sequence of amino acid substitutions

    • Identify lineage-specific changes that may relate to habitat shifts

Selection Analysis:

  • Detection of Selection Signatures:

    • Calculate dN/dS ratios across the rhodopsin sequence

    • Implement site-specific models to identify positively selected residues

    • Test branch-site models to detect episodic selection in specific lineages

  • Correlation with Ecological Factors:

    • Map habitat depth information onto the phylogeny

    • Test for correlations between specific amino acid substitutions and depth

    • Identify convergent substitutions in independent lineages occupying similar depths

Comparative Functional Analysis:

  • Heterologous Expression:

    • Express ancestral and modern rhodopsin variants

    • Include variants from species occupying different depths

    • Standardize expression and purification protocols for valid comparisons

  • Spectroscopic Analysis:

    • Measure absorption spectra of reconstructed pigments

    • Determine λmax values for ancestral and modern variants

    • Quantify functional shifts associated with specific substitutions

  • Structure-Function Relationships:

    • Model the structural consequences of observed substitutions

    • Identify mechanisms by which substitutions alter spectral properties

    • Develop predictive frameworks relating sequence to function

By integrating these approaches, researchers can reconstruct the evolutionary history of Paracottus kneri Rhodopsin, identify the selective pressures that shaped its evolution, and understand how specific molecular changes enabled adaptation to the unique light environment of Lake Baikal.

How do specific amino acid substitutions affect the spectral tuning of Paracottus kneri Rhodopsin?

The spectral tuning of rhodopsins, including Paracottus kneri Rhodopsin, is finely regulated by specific amino acid substitutions that modify the electronic environment around the retinal chromophore. Research on cottoid fish visual pigments has identified several key positions that influence spectral properties.

Key Spectral Tuning Sites:

Research on blue opsin genes from cottoid fish in Lake Baikal has identified three potential spectral tuning sites at positions 118, 215, and 269 . These positions likely have significant effects on spectral sensitivity, with the following proposed mechanisms:

PositionFunctionMechanism of Spectral TuningEffect on λmax
118Modifies chromophore environmentChanges electrostatic interactions with the chromophoreBlue-shift when polar residues are introduced
215Affects hydrogen bonding networkAlters stabilization of the protonated Schiff baseModulates λmax depending on hydrogen bonding capacity
269Influences electronic distributionModifies charge distribution in the conjugated systemBlue-shift when polar residues are introduced

Experimental Evidence and Methodology:

To determine the effects of specific substitutions, researchers have employed site-directed mutagenesis followed by heterologous expression and spectroscopic analysis . This approach has revealed that:

  • Single amino acid substitutions can shift the absorption maximum by several nanometers

  • The magnitude and direction of the shift depend on the physicochemical properties of the substituted amino acid

  • Multiple substitutions can have additive, synergistic, or antagonistic effects

  • The local protein environment influences how a particular substitution affects spectral tuning

Structural Basis of Spectral Tuning:

The mechanisms by which these substitutions affect spectral properties likely involve:

  • Electrostatic Effects:

    • Charged or polar residues near the chromophore alter the charge distribution

    • Changes in charge distribution affect the energy gap between ground and excited states

    • This directly influences the wavelength of maximum absorption

  • Steric Effects:

    • Changes in amino acid size can distort the chromophore geometry

    • Altered geometry affects the π-electron system of the chromophore

    • This modifies the energy required for electronic transitions

  • Hydrogen Bonding Networks:

    • Some substitutions alter hydrogen bonding patterns

    • These networks stabilize particular conformations of the chromophore

    • Changes in stabilization affect the energy levels of electronic states

Understanding these molecular mechanisms provides insights into how visual pigments adapt to different light environments through precisely targeted amino acid substitutions.

What techniques are used to analyze protein-chromophore interactions in Paracottus kneri Rhodopsin?

Advanced research on protein-chromophore interactions in Paracottus kneri Rhodopsin employs a multidisciplinary approach combining spectroscopic, structural, and computational techniques. These methods provide complementary insights into how the protein environment modulates chromophore properties.

Spectroscopic Techniques:

  • UV-Visible Absorption Spectroscopy:

    • Provides the primary measurement of λmax and spectral shape

    • Enables monitoring of photointermediates following light activation

    • Allows quantification of thermal stability and regeneration kinetics

  • Resonance Raman Spectroscopy:

    • Probes vibrational modes of the chromophore

    • Provides information about chromophore conformation and interactions

    • Identifies specific bonds affected by protein environment

  • Circular Dichroism (CD) Spectroscopy:

    • Examines protein secondary structure in the far-UV region

    • Probes chromophore environment in the visible region

    • Detects subtle changes in chromophore-protein interactions

Structural Biology Approaches:

  • X-ray Crystallography:
    While no crystal structure specific to Paracottus kneri Rhodopsin has been reported in the provided sources, this technique:

    • Provides atomic-level details of protein structure

    • Reveals chromophore binding pocket architecture

    • Identifies key residues interacting with the chromophore

  • Homology Modeling:

    • Generates structural models based on related rhodopsins with known structures

    • Predicts chromophore orientation and interactions

    • Identifies potential spectral tuning sites for experimental validation

Biochemical and Molecular Methods:

  • Site-Directed Mutagenesis:

    • Systematically modifies residues near the chromophore

    • Assesses effects on spectral properties and function

    • Verifies predictions from structural and computational analyses

  • Time-Resolved Spectroscopy:

    • Monitors conformational changes following photoactivation

    • Measures kinetics of photointermediates

    • Correlates structural changes with functional outcomes

Computational Approaches:

  • Molecular Dynamics Simulations:

    • Models dynamic interactions between protein and chromophore

    • Simulates effects of amino acid substitutions

    • Predicts energetic contributions to spectral tuning

  • Quantum Mechanical/Molecular Mechanical (QM/MM) Calculations:

    • Models electronic properties of the chromophore within the protein environment

    • Calculates absorption spectra from first principles

    • Identifies electronic mechanisms of spectral tuning

The integration of these diverse techniques provides a comprehensive understanding of how protein-chromophore interactions in Paracottus kneri Rhodopsin determine its spectral properties and how these properties have adapted to the specific light environment of Lake Baikal.

How can comparative studies of Paracottus kneri Rhodopsin contribute to our understanding of visual adaptation?

Comparative studies of Paracottus kneri Rhodopsin within the context of cottoid fish visual systems offer valuable insights into mechanisms of visual adaptation. Lake Baikal's cottoid fishes represent an ideal system for such studies because they form a species flock with representatives at various depths, and their visual pigments show adaptive shifts correlating with habitat depth .

Methodological Framework for Comparative Studies:

1. Phylogenetic and Molecular Evolution Analysis:

Researchers can sequence rhodopsin genes from multiple cottoid species inhabiting different depths in Lake Baikal and:

  • Construct phylogenetic trees to establish evolutionary relationships

  • Identify lineage-specific substitutions and convergent evolution

  • Map spectral tuning substitutions onto the phylogeny

  • Calculate selection pressures on different protein regions

  • Test for correlations between substitutions and habitat depth

2. Structure-Function Relationship Analysis:

By expressing rhodopsins from multiple species in standardized systems, researchers can:

  • Compare spectral properties under identical conditions

  • Correlate sequence differences with functional differences

  • Identify key substitutions responsible for adaptive shifts

  • Develop predictive models of how sequence determines function

3. Ecological and Environmental Correlation:

This approach involves:

  • Measuring light spectra at different depths in Lake Baikal

  • Modeling visual pigment sensitivity in natural light environments

  • Calculating visual performance metrics for different pigments

  • Evaluating the adaptive significance of observed spectral tuning

Research Insights from Comparative Studies:

Comparative studies of Paracottus kneri Rhodopsin contribute to understanding visual adaptation through:

  • Identifying Mechanisms of Spectral Tuning:
    By comparing rhodopsins from species inhabiting different depths, researchers can determine how specific amino acid substitutions shift absorption spectra and distinguish between alternative biochemical mechanisms. For instance, the identification of tuning sites at positions 118, 215, and 269 in blue opsins of cottoid fish provides a framework for understanding similar mechanisms in rhodopsin .

  • Revealing Evolutionary Processes:
    These studies demonstrate how sensory systems adapt to environmental conditions, revealing the relative roles of selection and drift in molecular evolution. The correlation between habitat depth and spectral properties in Lake Baikal cottoids suggests strong selective pressure for optimizing visual function in different light environments.

  • Developing Predictive Models:
    By correlating sequence variations with functional differences across species, researchers can develop models that predict how specific substitutions will affect spectral properties. These models can then be tested through site-directed mutagenesis and functional characterization .

Through these comparative approaches, studies of Paracottus kneri Rhodopsin contribute to our broader understanding of sensory adaptation at the molecular level, providing insights that extend beyond visual systems to general principles of protein evolution and environmental adaptation.

What are the most promising avenues for future research on Paracottus kneri Rhodopsin?

Future research on Paracottus kneri Rhodopsin presents several promising directions that could significantly advance our understanding of visual adaptation, protein function, and evolutionary biology:

1. Comprehensive Structural Characterization:
Despite the availability of the amino acid sequence and functional data, a high-resolution three-dimensional structure of Paracottus kneri Rhodopsin has not been reported in the provided sources. Future work should focus on:

  • Obtaining crystal structures or cryo-electron microscopy structures

  • Determining structures in both dark-state and photoactivated conformations

  • Comparing structural features with rhodopsins from species inhabiting different depths

  • Correlating structural differences with functional adaptations

2. In-depth Analysis of Spectral Tuning Mechanisms:
Building on the identification of potential tuning sites (positions 118, 215, and 269) in cottoid fish visual pigments , future research could:

  • Create comprehensive libraries of single and combinatorial mutants

  • Develop quantitative structure-function relationships

  • Investigate potential synergistic effects between distant residues

  • Explore the contribution of protein dynamics to spectral tuning

3. Environmental Adaptation and Visual Ecology:
The relationship between rhodopsin properties and the fish's visual ecology deserves further investigation:

  • Conduct in situ measurements of light spectra at different depths in Lake Baikal

  • Model visual performance under natural lighting conditions

  • Correlate rhodopsin properties with behavioral and ecological adaptations

  • Examine potential trade-offs between spectral tuning and other functional properties

4. Comparative Genomics and Transcriptomics:
Expanding beyond individual genes to genome-wide analyses could reveal:

  • Regulatory mechanisms controlling rhodopsin expression

  • Coordinated evolution of multiple components of the visual system

  • Potential gene duplications or losses in the evolutionary history of cottoid fishes

  • Signatures of selection across the visual transduction cascade

5. Optogenetic Applications:
The unique properties of Paracottus kneri Rhodopsin might be exploited for optogenetic applications:

  • Developing novel optogenetic tools based on its spectral properties

  • Creating chimeric proteins with specialized functions

  • Optimizing expression in mammalian neurons for neuroscience applications

  • Engineering variants with enhanced stability or spectral characteristics

6. Climate Change Impact Assessment:
As aquatic light environments may be affected by climate change, research could explore:

  • Potential effects of changing water transparency on visual system performance

  • Adaptive capacity of visual systems to rapid environmental changes

  • Implications for species interactions and ecosystem dynamics

  • Predictive models of visual adaptation under future climate scenarios

These research directions would not only advance our understanding of Paracottus kneri Rhodopsin specifically but would also contribute to broader questions in evolutionary biology, structural biochemistry, and sensory ecology.

What methodological challenges need to be overcome in Paracottus kneri Rhodopsin research?

Research on Paracottus kneri Rhodopsin faces several methodological challenges that must be addressed to advance our understanding of this protein's structure, function, and evolution. These challenges span multiple technical domains and require innovative approaches:

1. Protein Expression and Purification Challenges:

The expression and purification of functional rhodopsin presents significant challenges:

  • Membrane proteins like rhodopsin are notoriously difficult to express in heterologous systems

  • Proper folding and chromophore integration require specialized conditions

  • Purification must maintain protein stability while removing contaminants

  • Scale-up for structural studies requires consistent, high-yield protocols

Potential Solutions:

  • Optimize expression systems specifically for Paracottus kneri Rhodopsin

  • Develop specialized detergent mixtures for extraction and purification

  • Implement high-throughput screening of expression and purification conditions

  • Consider nanodiscs or other membrane mimetics for functional studies

2. Structural Biology Limitations:

Obtaining high-resolution structural data for rhodopsins remains challenging:

  • Crystallization of membrane proteins is inherently difficult

  • Capturing different functional states requires specialized approaches

  • Dynamic regions critical for function may be poorly resolved

  • Relating static structures to dynamic function presents conceptual challenges

Potential Solutions:

  • Apply recent advances in cryo-electron microscopy to rhodopsin studies

  • Combine structural data with molecular dynamics simulations

  • Implement time-resolved structural methods to capture intermediates

  • Develop integrative structural biology approaches combining multiple techniques

3. Functional Characterization Constraints:

Assessing the functional properties of rhodopsin variants presents technical challenges:

  • Spectroscopic measurements require specialized equipment and expertise

  • Quantifying subtle spectral shifts demands precise methodology

  • Connecting spectral properties to in vivo visual function remains difficult

  • Standardizing conditions across experiments for valid comparisons is essential

Potential Solutions:

  • Develop standardized protocols for spectroscopic analysis

  • Implement high-throughput functional assays for multiple variants

  • Create in vitro systems that better mimic in vivo conditions

  • Combine spectroscopic data with computational predictions for validation

4. Evolutionary Analysis Complexities:

Understanding the evolutionary history of Paracottus kneri Rhodopsin faces several obstacles:

  • Limited sampling of related species may bias evolutionary reconstructions

  • Distinguishing selection from genetic drift requires robust statistical approaches

  • Connecting molecular evolution to ecological adaptation presents conceptual challenges

  • Reconstructing ancestral proteins accurately becomes more difficult with evolutionary distance

Potential Solutions:

  • Expand taxonomic sampling of cottoid fishes from Lake Baikal

  • Apply sophisticated statistical models for detecting selection

  • Integrate ecological and environmental data into evolutionary analyses

  • Implement empirical testing of evolutionary hypotheses through ancestral protein reconstruction

Addressing these methodological challenges will require interdisciplinary collaboration and innovative approaches, but overcoming them will significantly advance our understanding of rhodopsin biology and visual adaptation in aquatic environments.

What are the key insights from current research on Paracottus kneri Rhodopsin?

Current research on Paracottus kneri Rhodopsin has yielded several significant insights into protein structure-function relationships, evolutionary adaptation, and the molecular basis of vision. The most important findings can be summarized as follows:

Molecular Basis of Spectral Tuning:
Research on cottoid fish visual pigments from Lake Baikal has identified specific amino acid positions (notably 118, 215, and 269) as key determinants of spectral sensitivity . These findings suggest that precise molecular modifications at critical sites can significantly alter the wavelength of maximum absorption (λmax), allowing fine-tuning of visual pigments to specific light environments.

Evolutionary Adaptation to Depth:
The cottoid fishes of Lake Baikal, including Paracottus kneri, demonstrate a pattern of short-wave shifted visual pigments with increasing habitat depth . This correlation between molecular properties and ecological niche provides compelling evidence for adaptive evolution in sensory systems, showing how natural selection can shape protein function in response to environmental conditions.

Structure-Function Relationships:
Studies using site-directed mutagenesis and heterologous expression have revealed how specific amino acid substitutions affect rhodopsin function . These experimental approaches have elucidated the mechanistic basis of spectral tuning, demonstrating how changes in the electronic environment around the chromophore can shift absorption properties.

Methodological Advances:
The research on Paracottus kneri and related cottoid fish visual pigments has involved the development and refinement of techniques for studying membrane proteins, including:

  • Optimized expression systems for recombinant rhodopsins

  • Protocols for functional characterization of visual pigments

  • Approaches for correlating sequence variation with spectral properties

  • Methods for analyzing selection pressures on visual pigment genes

Biodiversity and Specialization:
The stone sculpin (Paracottus knerii) represents just one component of the remarkable adaptive radiation of cottoid fishes in Lake Baikal . This biodiversity provides a natural laboratory for studying how visual systems evolve in response to ecological specialization, offering insights into the broader patterns and processes of sensory evolution.

These insights from Paracottus kneri Rhodopsin research contribute to our fundamental understanding of protein evolution, sensory biology, and environmental adaptation, while also providing a foundation for potential applications in fields ranging from optogenetics to biomedical research.

How does research on Paracottus kneri Rhodopsin contribute to broader scientific understanding?

Research on Paracottus kneri Rhodopsin extends beyond its specific molecular properties to contribute significantly to broader scientific understanding across multiple disciplines:

Evolutionary Biology:
The study of Paracottus kneri Rhodopsin provides a compelling example of molecular adaptation to environmental conditions. The correlation between habitat depth and visual pigment properties in Lake Baikal cottoid fishes demonstrates how natural selection can fine-tune protein function . This research contributes to our understanding of:

  • Mechanisms of adaptive molecular evolution

  • The role of selection versus genetic drift in protein evolution

  • How sensory systems respond to environmental challenges

  • Patterns of convergent evolution in similar ecological contexts

Structural Biochemistry:
Investigations into the structure-function relationships of Paracottus kneri Rhodopsin advance our understanding of how protein structure determines function. The identification of specific amino acid positions that influence spectral tuning illuminates:

  • How subtle molecular changes can significantly alter protein function

  • The importance of the protein environment in modulating chromophore properties

  • Mechanisms by which membrane proteins interact with small molecules

  • Principles that could be applied to protein engineering and design

Sensory Ecology:
Research on this visual pigment contributes to the field of sensory ecology by demonstrating how sensory systems adapt to specific environmental challenges:

  • How visual pigments evolve to match the available light spectrum

  • The relationship between habitat specialization and sensory adaptation

  • Tradeoffs between different aspects of visual performance

  • How sensory adaptations influence ecological interactions and niche partitioning

Biomedical and Biotechnological Applications:
Understanding the molecular basis of rhodopsin function has implications for:

  • Developing treatments for retinal diseases involving rhodopsin dysfunction

  • Creating improved optogenetic tools for neuroscience research

  • Engineering light-sensitive proteins with specific properties

  • Designing novel biosensors based on rhodopsin principles

Environmental Science:
The adaptation of visual pigments to specific light environments provides a framework for understanding how aquatic organisms might respond to changing water conditions due to climate change or pollution:

  • How changes in water clarity might affect visual systems

  • The potential for organisms to adapt to rapidly changing environments

  • The importance of sensory biology in conservation planning

  • Methods for monitoring ecosystem health through sensory biology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.