MT-ND3 from Paralichthys olivaceus is encoded by the mitochondrial genome and comprises 116 amino acid residues. The full amino acid sequence is as follows: "MSLLMTIITITALLSTILAIVSFWLPQISPDHEKLSPYECGFDPMGSARLPFSLRFFLIAILFLLFDLEIALLLPLPWGDQLPTPLLTFTWATAVLFLLTLGLIYEWIQGGLEWAE" . This hydrophobic protein is characterized by multiple transmembrane domains that anchor it within the inner mitochondrial membrane, where it functions as part of the larger NADH-ubiquinone oxidoreductase complex (Complex I).
The MT-ND3 gene is also known by several alternative names, including MTND3, NADH3, and ND3 . In fish mitochondrial genomes, the gene follows the typical vertebrate mitochondrial gene organization pattern, although variations have been observed across different fish species . The MT-ND3 gene in Paralichthys olivaceus is located on the H-strand of the mitochondrial genome, consistent with the pattern observed in most vertebrates where the majority of genes are encoded on the H-strand, with only ND6 and eight tRNA genes encoded on the L-strand .
MT-ND3 functions as a critical component of the NADH-ubiquinone oxidoreductase complex (Complex I) in the mitochondrial electron transport chain. This complex catalyzes the transfer of electrons from NADH to ubiquinone, coupled with the translocation of protons across the inner mitochondrial membrane . This process is a fundamental step in oxidative phosphorylation, the primary mechanism for ATP production in aerobic organisms.
The NADH-ubiquinone oxidoreductase complex, of which MT-ND3 is a component, possesses enzymatic activity classified as EC 7.1.1.2 . This activity involves the oxidation of NADH, transferring electrons to ubiquinone and ultimately contributing to the electrochemical gradient that drives ATP synthesis through ATP synthase.
The MT-ND3 protein is highly conserved across vertebrate species, reflecting its essential role in cellular energy metabolism. While the specific amino acid sequence may vary between species, the functional domains and catalytic sites show significant conservation. This evolutionary preservation underscores the critical nature of this protein in mitochondrial function and cellular energetics .
Recombinant Paralichthys olivaceus MT-ND3 is typically produced using advanced expression systems designed to accommodate membrane proteins. Although the search results do not specify the exact expression system used for the commercial product, recombinant mitochondrial proteins are generally challenging to express due to their hydrophobic nature and membrane-bound characteristics.
The expression region for the recombinant protein spans amino acids 1-116, representing the full-length protein . Various tag types may be incorporated during the production process to facilitate purification and detection of the recombinant protein.
Recombinant Paralichthys olivaceus MT-ND3 is commercially available for use in Enzyme-Linked Immunosorbent Assay (ELISA) applications . ELISA techniques utilizing this recombinant protein can be valuable for:
Detection of antibodies against MT-ND3 in research settings
Studies of mitochondrial function in fish species
Comparative studies of mitochondrial proteins across different organisms
Mutations in MT-ND3 are associated with mitochondrial disorders in humans, including Leigh syndrome and mitochondrial complex I deficiency . Recombinant MT-ND3 from Paralichthys olivaceus can serve as a model for understanding the consequences of mutations in this gene. Recent research has demonstrated that:
MT-ND3 variants can significantly impact protein levels
Mutations may cause complex I assembly and activity deficiency
The mitochondrial genomes of fish, including Paralichthys olivaceus, typically contain 37 genes arranged in a specific order. While gene rearrangements have been observed in some fish species, the MT-ND3 gene generally maintains a conserved position within the mitochondrial genome . Extensive comparative studies of fish mitochondrial genomes have revealed:
Conservation of gene order across many fish species
Variations in intergenic regions and occasional gene overlaps
Specific patterns of nucleotide substitution in mitochondrial genes
The conservation of MT-ND3 across diverse fish species reflects the evolutionary importance of this protein in mitochondrial function. Phylogenetic analysis of mitochondrial genes, including MT-ND3, provides valuable insights into the evolutionary relationships among fish species and the adaptive significance of mitochondrial gene variations .
Recent research has explored innovative approaches to address mitochondrial disorders associated with MT-ND3 mutations. One promising strategy involves:
Codon optimization of mitochondrial genes for nuclear expression
Translation by cytoplasmic ribosomes
This approach has shown potential for rescuing defects arising from MT-ND3 variants, with studies demonstrating partial restoration of protein levels, complex I function, and ATP production .
As Paralichthys olivaceus (Japanese flounder) is an economically important aquaculture species, research on its mitochondrial proteins, including MT-ND3, has potential applications in:
Selective breeding programs
Monitoring fish health and metabolism
Understanding adaptation to environmental stressors
Future studies on recombinant Paralichthys olivaceus MT-ND3 may focus on:
Detailed structural characterization using advanced techniques
Functional comparisons with MT-ND3 from other species
Development of additional diagnostic tools and research reagents
Exploration of potential applications in mitochondrial medicine
MT-ND3 (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 3) is a protein-coding gene that functions as a core subunit of mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) . In Paralichthys olivaceus (Japanese flounder), as in other vertebrates, this protein catalyzes electron transfer from NADH through the respiratory chain using ubiquinone as an electron acceptor . The protein is essential for the catalytic activity of Complex I, which is the first enzyme in the mitochondrial electron transport chain . The amino acid sequence for P. olivaceus MT-ND3 comprises 116 amino acids and includes the catalytic domain necessary for NADH dehydrogenase activity .
While both proteins serve similar functions in mitochondrial Complex I, P. olivaceus MT-ND3 shows several structural differences from its human homolog. The P. olivaceus MT-ND3 has an amino acid sequence that includes regions specialized for adaptation to aquatic environments. The protein sequence (MSLLMTIITITALLSTILAIVSFWLPQISPDHEKLSPYECGFDPMGSARLPFSLRFFLIA ILFLLFDLEIALLLPLPWGDQLPTPLLTFTWATAVLFLLTLGLIYEWIQGGLEWAE) contains transmembrane domains that are optimized for function in the fish's cellular environment . Comparative analysis with human MT-ND3 provides insights into evolutionarily conserved regions that are crucial for Complex I function across species.
For optimal stability and activity of recombinant P. olivaceus MT-ND3, storage at -20°C in a Tris-based buffer with 50% glycerol is recommended . For extended storage periods, maintaining the protein at -80°C is advisable . To prevent protein degradation, repeated freeze-thaw cycles should be avoided. Working aliquots can be stored at 4°C for up to one week . When handling the protein, it's important to maintain sterile conditions and minimize exposure to proteases that could degrade the sample.
When designing Complex I activity assays using recombinant P. olivaceus MT-ND3, researchers should consider the following methodological approaches:
Buffer composition: Use a physiologically relevant buffer system (pH 7.2-7.4) containing phosphate or HEPES with added magnesium ions.
Substrate concentration: Optimize NADH concentration (typically 50-200 μM) and ubiquinone analog concentration (CoQ10 or CoQ1, 50-100 μM).
Temperature control: For fish proteins, conduct assays at 15-25°C to reflect the physiological temperature range of P. olivaceus.
Inhibitor controls: Include rotenone (1-5 μM) as a specific Complex I inhibitor to verify specificity of measured activity.
Detection method: Monitor NADH oxidation spectrophotometrically at 340 nm or use colorimetric electron acceptors like dichlorophenolindophenol (DCPIP).
Similar methodologies have been applied in studies of other species' MT-ND3 proteins, showing significant reductions in Complex I activity with mutations in the gene .
For reconstitution experiments, the following methodology has proven effective:
Preparation of liposomes: Create phospholipid liposomes using a mixture of phosphatidylcholine and phosphatidylethanolamine (7:3 ratio) by sonication or extrusion.
Protein incorporation: Mix recombinant MT-ND3 (10-50 μg) with destabilized liposomes in the presence of mild detergents (0.1-0.5% dodecyl maltoside).
Detergent removal: Use Bio-Beads or dialysis to remove detergent and allow protein incorporation into liposomes.
Functional assessment: Measure proton pumping ability using pH-sensitive fluorescent dyes (ACMA or pyranine).
Verification: Confirm protein orientation using protease protection assays and antibody accessibility.
This protocol allows researchers to study the specific contribution of MT-ND3 to proton translocation and electron transfer in a controlled environment similar to methodologies used in mitochondrial protein research .
To conduct comparative evolutionary studies of Complex I function using P. olivaceus MT-ND3:
Sequence alignment: Perform multiple sequence alignment of MT-ND3 from diverse species including fish, mammals, and other vertebrates using tools like MUSCLE or Clustal Omega.
Functional domain mapping: Identify conserved domains across species using sequence conservation and available structural data.
Site-directed mutagenesis: Generate variants of conserved residues in the recombinant protein to assess functional impact.
Heterologous expression systems: Express P. olivaceus MT-ND3 in mammalian cell lines with MT-ND3 deficiency to assess cross-species complementation.
Respiratory chain activity measurement: Compare Complex I activity between native and heterologous systems using oxygen consumption rates and ATP production assays.
This approach can reveal insights into evolutionary adaptations in mitochondrial function across different environmental niches and metabolic demands .
For investigating heteroplasmy (the presence of multiple mitochondrial DNA variants) in MT-ND3 of fish models:
Tissue sampling: Collect diverse tissues (muscle, liver, brain, blood) with different metabolic activities.
DNA extraction: Use specialized protocols for mitochondrial DNA isolation to minimize nuclear DNA contamination.
Next-generation sequencing: Employ deep sequencing (>1000x coverage) using platforms like Illumina MiSeq or HiSeq.
Variant calling: Use specialized variant callers for mitochondrial DNA that can detect heteroplasmy at levels as low as 1%.
Validation: Confirm heteroplasmy using orthogonal methods such as digital droplet PCR or last-cycle hot PCR.
Quantification: Measure heteroplasmy levels across tissues and correlate with tissue-specific phenotypes.
This methodology has been applied in human studies showing that MT heteroplasmy patterns differ between blood and brain tissues and can be associated with neurodegenerative conditions like Alzheimer's disease .
To assess environmental impacts on MT-ND3:
Experimental design: Expose P. olivaceus to relevant stressors (temperature shifts, hypoxia, pollutants) in controlled environments.
Gene expression analysis: Quantify MT-ND3 mRNA levels using qRT-PCR with appropriate reference genes.
Protein analysis: Measure MT-ND3 protein levels via Western blotting or targeted proteomics.
Functional assays: Assess Complex I activity using spectrophotometric assays of NADH oxidation.
ATP production measurement: Quantify cellular ATP levels using luminescence-based assays.
ROS detection: Measure reactive oxygen species using fluorescent probes like MitoSOX or DCF-DA.
This comprehensive approach allows correlation between environmental stressors, mitochondrial gene expression, and functional outcomes at the cellular level.
When encountering low activity in reconstitution experiments:
Protein quality assessment: Verify protein integrity using SDS-PAGE and mass spectrometry.
Cofactor supplementation: Ensure sufficient iron-sulfur cluster formation by adding iron salts (5-10 μM) and sulfur sources.
Lipid composition adjustment: Optimize phospholipid composition to better match native mitochondrial membranes by including cardiolipin (10-20%).
Detergent optimization: Test multiple detergents (digitonin, dodecyl maltoside, CHAPS) at varying concentrations (0.1-1%).
Protein-to-lipid ratio: Adjust the protein-to-lipid ratio to achieve optimal incorporation without aggregation.
Temperature and pH optimization: Fine-tune these parameters based on the physiological conditions of P. olivaceus.
This systematic troubleshooting approach can significantly improve activity in reconstitution experiments, similar to methods applied in human MT-ND3 studies .
When planning site-directed mutagenesis:
Target selection: Prioritize evolutionarily conserved residues identified through multiple sequence alignment.
Disease-associated variants: Consider mutations homologous to those causing human conditions like Leigh syndrome or Complex I deficiency.
Primer design: Design primers with appropriate melting temperatures (Tm > 78°C) and sufficient overlap with the template.
Codon optimization: Consider codon usage bias in expression systems to ensure efficient translation.
Verification: Confirm mutations by sequencing the entire gene to exclude unintended changes.
Functional assessment: Compare mutant proteins with wild-type using consistent activity assays.
This approach enables systematic structure-function analysis of MT-ND3 and can provide insights into the molecular mechanisms of mitochondrial diseases associated with MT-ND3 mutations .
Allotopic expression (nuclear expression of mitochondrial genes) can be applied to study P. olivaceus MT-ND3 through:
Codon optimization: Redesign the MT-ND3 gene using nuclear codon preferences while maintaining the amino acid sequence.
Mitochondrial targeting sequence addition: Incorporate efficient targeting sequences (e.g., from Cox8 or ATP5B) at the N-terminus.
Vector construction: Clone the optimized gene into mammalian expression vectors with strong promoters (CMV or EF1α).
Transfection methods: Use lipofection or electroporation to introduce constructs into cell lines.
Import verification: Confirm mitochondrial localization using immunofluorescence and subcellular fractionation.
Functional complementation: Express the construct in cells with MT-ND3 deficiency to assess functional rescue.
This technique has successfully been used to restore mitochondrial function in human cells with MT-ND3 variants, demonstrating significant improvement in Complex I assembly, activity, and ATP production .
Current cutting-edge approaches include:
Single-cell sequencing: Analyze MT-ND3 heteroplasmy at the single-cell level to understand cellular mosaicism.
CRISPR-based mitochondrial DNA editing: Apply newly developed techniques for targeted modification of MT-ND3.
Induced pluripotent stem cells (iPSCs): Generate disease-specific models by reprogramming cells from patients with MT-ND3 variants.
Organoid models: Develop tissue-specific organoids to study MT-ND3 variants in relevant cellular contexts.
In vivo imaging: Use specialized probes to visualize mitochondrial function in living systems.
Computational modeling: Apply systems biology approaches to predict the impact of MT-ND3 variants on mitochondrial network function.
To investigate protein-protein interactions:
Cross-linking mass spectrometry: Apply chemical cross-linkers followed by mass spectrometry to identify interaction sites.
Förster resonance energy transfer (FRET): Tag MT-ND3 and potential interacting partners with fluorescent proteins to detect proximity in living cells.
Co-immunoprecipitation: Use antibodies against MT-ND3 to pull down interacting proteins, followed by mass spectrometry identification.
Yeast two-hybrid adaptations: Apply specialized systems designed for membrane protein interactions.
Cryo-electron microscopy: Determine structural arrangements within the assembled Complex I at near-atomic resolution.
In silico molecular docking: Use computational approaches to predict interaction surfaces between MT-ND3 and other subunits.
These methods provide complementary information about the structural and functional relationships of MT-ND3 within the Complex I machinery .