Recombinant Paralichthys olivaceus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

What is MT-ND3 and what is its function in Paralichthys olivaceus?

MT-ND3 (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 3) is a protein-coding gene that functions as a core subunit of mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) . In Paralichthys olivaceus (Japanese flounder), as in other vertebrates, this protein catalyzes electron transfer from NADH through the respiratory chain using ubiquinone as an electron acceptor . The protein is essential for the catalytic activity of Complex I, which is the first enzyme in the mitochondrial electron transport chain . The amino acid sequence for P. olivaceus MT-ND3 comprises 116 amino acids and includes the catalytic domain necessary for NADH dehydrogenase activity .

How does P. olivaceus MT-ND3 differ structurally from human MT-ND3?

While both proteins serve similar functions in mitochondrial Complex I, P. olivaceus MT-ND3 shows several structural differences from its human homolog. The P. olivaceus MT-ND3 has an amino acid sequence that includes regions specialized for adaptation to aquatic environments. The protein sequence (MSLLMTIITITALLSTILAIVSFWLPQISPDHEKLSPYECGFDPMGSARLPFSLRFFLIA ILFLLFDLEIALLLPLPWGDQLPTPLLTFTWATAVLFLLTLGLIYEWIQGGLEWAE) contains transmembrane domains that are optimized for function in the fish's cellular environment . Comparative analysis with human MT-ND3 provides insights into evolutionarily conserved regions that are crucial for Complex I function across species.

What are the recommended storage conditions for recombinant P. olivaceus MT-ND3?

For optimal stability and activity of recombinant P. olivaceus MT-ND3, storage at -20°C in a Tris-based buffer with 50% glycerol is recommended . For extended storage periods, maintaining the protein at -80°C is advisable . To prevent protein degradation, repeated freeze-thaw cycles should be avoided. Working aliquots can be stored at 4°C for up to one week . When handling the protein, it's important to maintain sterile conditions and minimize exposure to proteases that could degrade the sample.

What are the optimal conditions for using recombinant P. olivaceus MT-ND3 in Complex I activity assays?

When designing Complex I activity assays using recombinant P. olivaceus MT-ND3, researchers should consider the following methodological approaches:

• Buffer composition: Use a physiologically relevant buffer system (pH 7.2-7.4) containing phosphate or HEPES with added magnesium ions.

• Substrate concentration: Optimize NADH concentration (typically 50-200 μM) and ubiquinone analog concentration (CoQ10 or CoQ1, 50-100 μM).

• Temperature control: For fish proteins, conduct assays at 15-25°C to reflect the physiological temperature range of P. olivaceus.

• Inhibitor controls: Include rotenone (1-5 μM) as a specific Complex I inhibitor to verify specificity of measured activity.

• Detection method: Monitor NADH oxidation spectrophotometrically at 340 nm or use colorimetric electron acceptors like dichlorophenolindophenol (DCPIP).

Similar methodologies have been applied in studies of other species' MT-ND3 proteins, showing significant reductions in Complex I activity with mutations in the gene .

How can I integrate recombinant P. olivaceus MT-ND3 into reconstitution experiments?

For reconstitution experiments, the following methodology has proven effective:

• Preparation of liposomes: Create phospholipid liposomes using a mixture of phosphatidylcholine and phosphatidylethanolamine (7:3 ratio) by sonication or extrusion.

• Protein incorporation: Mix recombinant MT-ND3 (10-50 μg) with destabilized liposomes in the presence of mild detergents (0.1-0.5% dodecyl maltoside).

• Detergent removal: Use Bio-Beads or dialysis to remove detergent and allow protein incorporation into liposomes.

• Functional assessment: Measure proton pumping ability using pH-sensitive fluorescent dyes (ACMA or pyranine).

• Verification: Confirm protein orientation using protease protection assays and antibody accessibility.

This protocol allows researchers to study the specific contribution of MT-ND3 to proton translocation and electron transfer in a controlled environment similar to methodologies used in mitochondrial protein research .

How can I use recombinant P. olivaceus MT-ND3 to study evolutionary conservation of Complex I function?

To conduct comparative evolutionary studies of Complex I function using P. olivaceus MT-ND3:

• Sequence alignment: Perform multiple sequence alignment of MT-ND3 from diverse species including fish, mammals, and other vertebrates using tools like MUSCLE or Clustal Omega.

• Functional domain mapping: Identify conserved domains across species using sequence conservation and available structural data.

• Site-directed mutagenesis: Generate variants of conserved residues in the recombinant protein to assess functional impact.

• Heterologous expression systems: Express P. olivaceus MT-ND3 in mammalian cell lines with MT-ND3 deficiency to assess cross-species complementation.

• Respiratory chain activity measurement: Compare Complex I activity between native and heterologous systems using oxygen consumption rates and ATP production assays.

This approach can reveal insights into evolutionary adaptations in mitochondrial function across different environmental niches and metabolic demands .

What methods are recommended for studying MT-ND3 heteroplasmy in fish models?

For investigating heteroplasmy (the presence of multiple mitochondrial DNA variants) in MT-ND3 of fish models:

• Tissue sampling: Collect diverse tissues (muscle, liver, brain, blood) with different metabolic activities.

• DNA extraction: Use specialized protocols for mitochondrial DNA isolation to minimize nuclear DNA contamination.

• Next-generation sequencing: Employ deep sequencing (>1000x coverage) using platforms like Illumina MiSeq or HiSeq.

• Variant calling: Use specialized variant callers for mitochondrial DNA that can detect heteroplasmy at levels as low as 1%.

• Validation: Confirm heteroplasmy using orthogonal methods such as digital droplet PCR or last-cycle hot PCR.

• Quantification: Measure heteroplasmy levels across tissues and correlate with tissue-specific phenotypes.

This methodology has been applied in human studies showing that MT heteroplasmy patterns differ between blood and brain tissues and can be associated with neurodegenerative conditions like Alzheimer's disease .

How can I investigate the effect of environmental stressors on P. olivaceus MT-ND3 expression and function?

To assess environmental impacts on MT-ND3:

• Experimental design: Expose P. olivaceus to relevant stressors (temperature shifts, hypoxia, pollutants) in controlled environments.

• Gene expression analysis: Quantify MT-ND3 mRNA levels using qRT-PCR with appropriate reference genes.

• Protein analysis: Measure MT-ND3 protein levels via Western blotting or targeted proteomics.

• Functional assays: Assess Complex I activity using spectrophotometric assays of NADH oxidation.

• ATP production measurement: Quantify cellular ATP levels using luminescence-based assays.

• ROS detection: Measure reactive oxygen species using fluorescent probes like MitoSOX or DCF-DA.

This comprehensive approach allows correlation between environmental stressors, mitochondrial gene expression, and functional outcomes at the cellular level.

How can I address low Complex I activity when using recombinant P. olivaceus MT-ND3 in reconstitution experiments?

When encountering low activity in reconstitution experiments:

• Protein quality assessment: Verify protein integrity using SDS-PAGE and mass spectrometry.

• Cofactor supplementation: Ensure sufficient iron-sulfur cluster formation by adding iron salts (5-10 μM) and sulfur sources.

• Lipid composition adjustment: Optimize phospholipid composition to better match native mitochondrial membranes by including cardiolipin (10-20%).

• Detergent optimization: Test multiple detergents (digitonin, dodecyl maltoside, CHAPS) at varying concentrations (0.1-1%).

• Protein-to-lipid ratio: Adjust the protein-to-lipid ratio to achieve optimal incorporation without aggregation.

• Temperature and pH optimization: Fine-tune these parameters based on the physiological conditions of P. olivaceus.

This systematic troubleshooting approach can significantly improve activity in reconstitution experiments, similar to methods applied in human MT-ND3 studies .

What are the key considerations for designing site-directed mutagenesis experiments with P. olivaceus MT-ND3?

When planning site-directed mutagenesis:

• Target selection: Prioritize evolutionarily conserved residues identified through multiple sequence alignment.

• Disease-associated variants: Consider mutations homologous to those causing human conditions like Leigh syndrome or Complex I deficiency.

• Primer design: Design primers with appropriate melting temperatures (Tm > 78°C) and sufficient overlap with the template.

• Codon optimization: Consider codon usage bias in expression systems to ensure efficient translation.

• Verification: Confirm mutations by sequencing the entire gene to exclude unintended changes.

• Functional assessment: Compare mutant proteins with wild-type using consistent activity assays.

This approach enables systematic structure-function analysis of MT-ND3 and can provide insights into the molecular mechanisms of mitochondrial diseases associated with MT-ND3 mutations .

How can allotopic expression techniques be applied to study P. olivaceus MT-ND3 function?

Allotopic expression (nuclear expression of mitochondrial genes) can be applied to study P. olivaceus MT-ND3 through:

• Codon optimization: Redesign the MT-ND3 gene using nuclear codon preferences while maintaining the amino acid sequence.

• Mitochondrial targeting sequence addition: Incorporate efficient targeting sequences (e.g., from Cox8 or ATP5B) at the N-terminus.

• Vector construction: Clone the optimized gene into mammalian expression vectors with strong promoters (CMV or EF1α).

• Transfection methods: Use lipofection or electroporation to introduce constructs into cell lines.

• Import verification: Confirm mitochondrial localization using immunofluorescence and subcellular fractionation.

• Functional complementation: Express the construct in cells with MT-ND3 deficiency to assess functional rescue.

This technique has successfully been used to restore mitochondrial function in human cells with MT-ND3 variants, demonstrating significant improvement in Complex I assembly, activity, and ATP production .

What are the current approaches for investigating the role of MT-ND3 variants in mitochondrial heteroplasmy and disease?

Current cutting-edge approaches include:

• Single-cell sequencing: Analyze MT-ND3 heteroplasmy at the single-cell level to understand cellular mosaicism.

• CRISPR-based mitochondrial DNA editing: Apply newly developed techniques for targeted modification of MT-ND3.

• Induced pluripotent stem cells (iPSCs): Generate disease-specific models by reprogramming cells from patients with MT-ND3 variants.

• Organoid models: Develop tissue-specific organoids to study MT-ND3 variants in relevant cellular contexts.

• In vivo imaging: Use specialized probes to visualize mitochondrial function in living systems.

• Computational modeling: Apply systems biology approaches to predict the impact of MT-ND3 variants on mitochondrial network function.

What methodologies can be used to study the interaction between P. olivaceus MT-ND3 and other Complex I subunits?

To investigate protein-protein interactions:

• Cross-linking mass spectrometry: Apply chemical cross-linkers followed by mass spectrometry to identify interaction sites.

• Förster resonance energy transfer (FRET): Tag MT-ND3 and potential interacting partners with fluorescent proteins to detect proximity in living cells.

• Co-immunoprecipitation: Use antibodies against MT-ND3 to pull down interacting proteins, followed by mass spectrometry identification.

• Yeast two-hybrid adaptations: Apply specialized systems designed for membrane protein interactions.

• Cryo-electron microscopy: Determine structural arrangements within the assembled Complex I at near-atomic resolution.

• In silico molecular docking: Use computational approaches to predict interaction surfaces between MT-ND3 and other subunits.

These methods provide complementary information about the structural and functional relationships of MT-ND3 within the Complex I machinery .