Recombinant Parana virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
273-507
Protein Length
Full Length of Mature Protein
Species
Parana mammarenavirus (isolate Rat/Paraguay/12056/1965) (PARV) (Paran mammarenavirus)
Target Names
GPC
Target Protein Sequence
GFFTWDISDSSGRHVPGGYCLEQWALVWAGIKCFDNSVMAKCNKDHNEEFCDTMRLFDFN QNAIKTLQLNTENSINLLKRSINGLISDSLVIRNSLKQLARIPYCNYTKFWYVNDTITKR HSLPQCWLTYNGSYLNETHFRNDWLLESQQLYNDMLVKEYEERQGKTPIALTDICFWSLV YFTVSVFLQLVGIPSHRHIVGQGCPKPHRISRNGLCSCGYYNIPMKPVRWVRKGK
Uniprot No.

Target Background

Function
Recombinant Parana virus Pre-glycoprotein polyprotein GP complex (GPC) is a class I viral fusion protein that mediates fusion between viral and host endosomal membranes, enabling nucleocapsid delivery into the cytoplasm. This fusion is driven by irreversible conformational changes triggered by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide while also remaining a component of the GP complex. The SSP is essential for efficient glycoprotein expression, post-translational maturation (GP1 and GP2 cleavage), glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent glycoprotein-mediated cell fusion. The GPC also interacts with the host receptor.
Database Links

KEGG: vg:6334528

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the Parana virus pre-glycoprotein polyprotein GP complex (GPC) and how is it processed?

Parana virus belongs to the mammarenavirus genus within the Arenaviridae family. The pre-glycoprotein polyprotein GP complex (GPC) is a precursor protein that undergoes post-translational modifications to form the mature viral envelope glycoproteins. After initial synthesis, the GPC is cleaved by signal peptidase to remove the signal peptide, then undergoes N-glycosylation in the endoplasmic reticulum to form pre-GP (approximately 100 kDa). Subsequently, it's further processed in the Golgi apparatus to produce fully glycosylated GP0 . The final processing step involves proteolytic cleavage by a host protease (typically SKI-1/S1P) into two subunits: GP1, which mediates receptor binding, and GP2, which is responsible for membrane fusion .

Unlike typical signal peptides that are degraded after cleavage, the stable signal peptide (SSP) of arenavirus GPC remains associated with the GP1-GP2 complex and plays critical roles in protein trafficking, processing, and fusion activity .

How does recombinant Parana virus GPC differ from the native viral protein?

Recombinant Parana virus GPC produced in expression systems such as E. coli contains the amino acid sequence of the viral glycoprotein but may differ from the native form in several ways:

  • Glycosylation patterns: When expressed in E. coli, the protein lacks eukaryotic post-translational modifications, particularly the complex N-glycosylation present in native viral GPC.

  • Protein tagging: Recombinant proteins are often produced with affinity tags such as histidine (His) tags to facilitate purification. The specific recombinant Parana virus pre-glycoprotein polyprotein GPC described in the literature features an N-terminal His tag .

  • Protein domain selection: Recombinant proteins may consist of the full-length GPC or selected domains. For example, one commercially available recombinant Parana virus GPC protein encompasses amino acids 273-507 of the mature protein .

  • Proteolytic processing: Recombinant GPC expressed in bacterial systems typically lacks the proper proteolytic processing into GP1 and GP2 subunits that occurs in mammalian cells.

What experimental methods are used to study Parana virus GPC structure and function?

Several methodological approaches are employed to investigate Parana virus GPC:

  • Recombinant protein expression: Using bacterial (E. coli), insect, or mammalian expression systems to produce the protein for structural and functional studies .

  • Epitope tagging: Inserting epitope tags such as hemagglutinin (HA) into specific regions of the GPC to track protein processing and localization without disrupting function .

  • Site-directed mutagenesis: Creating point mutations or deletions to identify critical residues and domains involved in protein folding, processing, and function .

  • Pseudotyped virus systems: Using surrogate systems like HIV-based pseudotyped viruses to study viral entry while avoiding the safety concerns associated with live arenaviruses .

  • Immunofluorescence microscopy: Tracking the cellular localization and trafficking of GPC and its processed subunits .

  • Western blotting: Analyzing protein expression, processing, and incorporation into viral particles .

How can I optimize the expression and purification of functional recombinant Parana virus GPC for structural studies?

Optimizing expression and purification of functional Parana virus GPC requires addressing several technical challenges:

  • Expression system selection: While E. coli systems are commonly used for simple protein expression, mammalian or insect cell expression systems are preferable for producing properly folded and processed viral glycoproteins with native-like post-translational modifications.

  • Construct design considerations:

    • Include the complete coding sequence for mature GPC (amino acids 273-507 for Parana virus)

    • Incorporate appropriate affinity tags (His-tag) for purification

    • Consider incorporating protease cleavage sites to remove tags after purification

    • Optimize codon usage for the chosen expression system

  • Solubility enhancement strategies:

    • Express as fusion proteins with solubility-enhancing partners (MBP, GST)

    • Include appropriate detergents during extraction and purification

    • Consider expressing only specific domains rather than full-length GPC

  • Purification protocol:

    • Use immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Employ size exclusion chromatography to separate aggregates

    • Validate protein purity using SDS-PAGE (aim for >90% purity)

    • Store purified protein as lyophilized powder or in aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles

What mutagenesis approaches can identify critical residues in Parana virus GPC that affect viral entry?

Systematic mutagenesis studies provide valuable insights into structure-function relationships of viral glycoproteins. Based on approaches used for related arenaviruses, consider the following methodological framework:

  • Alanine scanning mutagenesis:

    • Systematically replace conserved amino acids with alanine

    • Focus on residues in the N-terminal region of GP1, which is likely involved in receptor binding (based on findings from related Ebola virus)

    • Create deletion mutants to map functional domains

  • Targeted mutagenesis of conserved motifs:

    • Identify and mutate conserved sequence motifs like the FLLL motif observed in related arenaviruses

    • Pay special attention to cysteine residues that may form disulfide bonds critical for structure

  • Functional assessment of mutants:

    • Analyze protein expression and processing via Western blotting

    • Assess incorporation into viral particles or pseudovirions

    • Measure entry efficiency using pseudotyped virus systems with reporter genes

    • Conduct cell-cell fusion assays to evaluate fusion activity

  • Data analysis framework:

Mutation CategoryExpression LevelGP ProcessingViral IncorporationEntry Efficiency
Wild-type+++CompleteEfficient100%
Receptor binding+++CompleteEfficientReduced
Protein folding+ or ++IncompletePoorReduced
Transport+++CompletePoorReduced
Fusion+++CompleteEfficientReduced

This approach enables classification of mutants based on their phenotypic effects, distinguishing between residues involved in receptor binding versus those affecting protein folding or transport .

How can I develop a pseudotyped virus system to study Parana virus GPC-mediated entry safely?

Pseudotyped virus systems offer a safer alternative to working with live arenaviruses while still allowing investigation of viral entry mechanisms. A methodological approach includes:

  • Vector selection and construction:

    • Use HIV-based or vesicular stomatitis virus (VSV)-based vectors lacking their native envelope genes

    • Clone the full-length Parana virus GPC gene into an appropriate expression vector (e.g., pCAGGS)

    • Include a reporter gene (luciferase or GFP) in the viral genome to quantify infection

  • Pseudovirus production protocol:

    • Transfect packaging cells (e.g., HEK293T) with:
      a. Vector encoding viral backbone with reporter gene
      b. Vector expressing Parana virus GPC

    • Harvest supernatant containing pseudotyped viruses 48-72 hours post-transfection

    • Filter through 0.45 μm filter to remove cellular debris

    • Concentrate pseudoviruses by ultracentrifugation if needed

  • Validation of pseudovirus system:

    • Confirm GPC incorporation into pseudovirions by Western blotting

    • Verify pseudovirus morphology by electron microscopy

    • Test entry in permissive and non-permissive cell lines

    • Include controls (VSV-G pseudotyped viruses as positive control; no envelope as negative control)

  • Entry inhibition studies:

    • Test neutralizing antibodies or entry inhibitors

    • Perform receptor competition assays

    • Evaluate pH-dependence of entry using ammonium chloride or bafilomycin A1

This system allows for high-throughput screening of entry inhibitors and detailed characterization of GPC mutants without the biosafety concerns associated with replication-competent arenaviruses .

What are the structural and functional differences between Parana virus GPC and other arenavirus glycoproteins?

Understanding the similarities and differences between arenavirus glycoproteins provides insights into virus-specific entry mechanisms and potential cross-reactive vaccine strategies:

  • Sequence comparison analysis:

    • Align GPC sequences from Parana virus with other arenaviruses (Lassa, Junín, LCMV)

    • Identify conserved domains and virus-specific regions

    • Pay particular attention to the GP1 N-terminal region, which is implicated in receptor binding

    • Analyze conservation of critical residues identified through mutagenesis studies

  • Structural domain comparison:

    • Signal peptide (SSP): Assess conservation of the myristoylation site and transmembrane domains

    • GP1: Compare putative receptor-binding domains

    • GP2: Analyze fusion peptide and transmembrane domain conservation

  • Receptor usage analysis:

    • New World arenaviruses (including Parana) typically use transferrin receptor 1 (TfR1)

    • Old World arenaviruses use α-dystroglycan or other receptors

    • Experimental approach: Conduct receptor binding assays using recombinant GP1 and cellular receptors

  • Antibody cross-reactivity testing:

    • Evaluate whether antibodies against Parana virus GPC cross-react with other arenavirus glycoproteins

    • Implications for diagnostic test development and vaccine design

The N-terminal 150 amino acids of GP1 appear particularly important for receptor binding in arenaviruses, with several critical residues forming potential receptor-binding pockets . Comparing these regions across different arenaviruses may reveal virus-specific entry mechanisms.

How does the stable signal peptide (SSP) of Parana virus GPC contribute to viral entry and fusion?

The arenavirus stable signal peptide (SSP) is unique among viral glycoproteins for its multifunctional roles beyond merely directing ER targeting. Based on studies with related arenaviruses, a comprehensive investigation of Parana virus SSP would include:

  • SSP structure-function analysis:

    • The SSP contains two hydrophobic domains that span the membrane

    • A conserved myristoylation site at the N-terminus anchors the SSP in the membrane

    • The C-terminal region interacts with the GP2 subunit

  • Experimental approaches for studying SSP function:

    • Create epitope-tagged SSP constructs (e.g., HA-tagged SSP) to track localization and interactions

    • Generate SSP mutants affecting key residues in transmembrane domains or the myristoylation site

    • Conduct SSP complementation assays by co-expressing wild-type or mutant SSP with GPC lacking its native SSP

    • Assess GPC processing, trafficking, and fusion activity in the presence of various SSP mutants

  • Membrane fusion regulation:

    • The SSP modulates the pH threshold for fusion activation

    • Mutations in the C-terminal region of SSP affect fusion activity without altering GPC processing

    • Investigate SSP-GP2 interactions that regulate this function

  • SSP as a target for antiviral strategies:

    • Screen for small molecules that disrupt SSP-GP2 interactions

    • Evaluate whether antibodies targeting exposed regions of SSP can neutralize virus

Understanding the unique properties of arenavirus SSP provides insights into virus-specific entry mechanisms and potential targets for therapeutic intervention.

What strategies exist for developing vaccines targeting Parana virus GPC?

Developing vaccines against Parana virus and related arenaviruses requires careful consideration of GPC's role in immune protection. Several approaches have shown promise:

  • Inactivated virus vectors expressing GPC:

    • Rabies virus-based platforms have shown success for related arenaviruses like Lassa fever virus

    • LASSARAB, a deactivated rabies virus vector encoding Lassa virus GPC, demonstrated strong protection in non-human primates

    • This approach could be adapted for Parana virus by substituting its GPC sequence

  • DNA vaccine approaches:

    • Advantages: Stable, relatively simple to produce

    • Limitations: Poor immunogenicity without specialized delivery techniques like electroporation

    • DNA vaccines encoding GPC have shown protection in animal models for related arenaviruses

  • RNA-based vaccines:

    • Advantages: Potent immune responses, rapid development pipeline

    • Disadvantages: Cold-chain storage requirements

    • Alphavirus RNA replicon vaccines have been explored for arenaviruses

  • Subunit vaccine approaches:

    • Express and purify recombinant GPC or GP1 as immunogens

    • Advantages: Safety profile, focus on neutralizing epitopes

    • Disadvantages: May not elicit full spectrum of protective responses

  • Live viral vectors:

    • Advantages: Strong immune responses, potential single-dose efficacy

    • Disadvantages: Safety concerns for immunocompromised individuals, potential for acquiring mutations

    • Not suitable for pregnant women or immunocompromised individuals

The choice of platform should consider the target population, required durability of protection, and logistical constraints of vaccine deployment in endemic regions.

What immune correlates of protection should be measured when evaluating Parana virus GPC-based vaccines?

Evaluating the efficacy of Parana virus GPC-based vaccines requires comprehensive assessment of immune responses:

  • Antibody responses:

    • Measure total anti-GPC IgG titers by ELISA

    • Assess neutralizing antibody titers using pseudovirus neutralization assays

    • Evaluate antibody epitope specificity (GP1 vs. GP2-directed responses)

    • Determine antibody avidity and isotype distribution

    • Monitor antibody persistence over time

  • T cell responses:

    • Measure CD4+ T cell responses by cytokine production (IFN-γ, IL-2)

    • Assess CD8+ T cell responses via intracellular cytokine staining and ELISpot

    • Determine T cell epitope specificity within GPC

    • Evaluate polyfunctionality of T cell responses

  • Challenge studies in animal models:

    • Measure viral load reduction following challenge

    • Assess survival rates and clinical scores

    • Monitor for adverse events and potential enhanced disease

  • Correlative analyses:

    • Identify statistical correlations between specific immune parameters and protection

    • Determine minimum protective thresholds for antibody or T cell responses

Based on studies with related arenaviruses like Lassa fever virus, strong humoral responses to GPC (particularly neutralizing antibodies targeting GP1) correlate with protection in non-human primates . The development of strong neutralizing antibody responses to GPC should be a primary endpoint in vaccine evaluation studies.

How can I set up a cell-cell fusion assay to evaluate Parana virus GPC fusion activity?

Cell-cell fusion assays provide valuable insights into the fusion properties of viral glycoproteins without requiring work with infectious virus. A detailed methodological approach includes:

  • Cell preparation:

    • Effector cells: Transfect cells (e.g., HEK293T) with Parana virus GPC expression vector

    • Target cells: Use cells expressing the appropriate receptor (e.g., TfR1 for New World arenaviruses)

    • Include controls: Cells expressing fusion-defective GPC mutants or irrelevant glycoproteins

  • Fusion detection methods:

    • Reporter gene method:

      • Transfect effector cells with T7 polymerase

      • Transfect target cells with reporter gene (luciferase or GFP) under T7 promoter

      • Fusion results in T7 polymerase driving reporter gene expression

    • Dye transfer method:

      • Label effector cells with cytoplasmic dye (e.g., calcein-AM)

      • Label target cell membranes with different dye (e.g., DiI)

      • Fusion results in dye redistribution, detectable by fluorescence microscopy

  • Assay conditions:

    • Co-culture effector and target cells at optimal density

    • For pH-dependent fusion, briefly expose cells to low pH buffer (pH 5.0-5.5)

    • Return to neutral pH and continue incubation (4-6 hours)

    • Measure reporter gene expression or dye redistribution

  • Applications:

    • Evaluate fusion efficiency of wild-type versus mutant GPC

    • Determine pH threshold for fusion activation

    • Screen for fusion inhibitors

    • Assess species-specificity of receptor usage

This assay allows for quantitative assessment of fusion activity and structure-function analysis of GPC domains involved in the fusion process .

What approaches can be used to study the interaction between Parana virus GPC and its cellular receptor?

Understanding the interactions between Parana virus GPC and its cellular receptor requires multiple complementary approaches:

Based on studies with related viruses, the N-terminal 150 residues of GP1 are likely critical for receptor binding, with specific amino acids forming a receptor-binding pocket .

What are the recommended protocols for expressing and analyzing Parana virus GPC in mammalian cell systems?

Expressing and analyzing Parana virus GPC in mammalian cells enables studies of authentic processing and function:

  • Expression vector construction:

    • Clone the full-length Parana virus GPC gene into a mammalian expression vector (e.g., pCAGGS)

    • Consider adding epitope tags (HA, FLAG) at strategic locations

    • For specific studies, create SSP-only or GP1/GP2-only constructs

  • Transfection protocols:

    • Cell lines: HEK293T or BHK-21 cells are commonly used

    • Transfection reagents: Lipofectamine 2000 is effective for most cell types

    • Timing: Analyze protein expression 24-48 hours post-transfection

  • Protein detection methods:

    • Western blotting:

      • Lyse cells in appropriate buffer containing protease inhibitors

      • Resolve proteins on SDS-PAGE (10-12% gels)

      • Transfer to PVDF or nitrocellulose membranes

      • Probe with antibodies against GPC, GP2, or epitope tags

      • Look for characteristic bands: full-length GPC (~70-75 kDa), cleaved GP2 (~35 kDa)

    • Immunofluorescence microscopy:

      • Fix cells with 4% paraformaldehyde

      • Permeabilize with 0.1% Triton X-100 for internal epitopes

      • Stain with appropriate antibodies

      • Counterstain organelle markers to determine subcellular localization

  • Processing analysis:

    • Use SKI-1/S1P inhibitors to block GPC cleavage

    • Employ glycosylation inhibitors (tunicamycin) or glycosidases (PNGase F, Endo H) to analyze glycosylation status

    • Create cleavage site mutants to assess processing requirements

  • Surface expression analysis:

    • Perform surface biotinylation assays

    • Use flow cytometry with antibodies against external epitopes

    • Compare total versus surface expression levels

These protocols allow for comprehensive analysis of GPC expression, processing, and trafficking in mammalian cells, providing insights into the protein's maturation pathway .

What are the most promising research directions for Parana virus GPC studies?

Based on current knowledge of arenavirus glycoproteins, several research directions hold particular promise:

  • Structure-based vaccine design:

    • Determine high-resolution structures of Parana virus GP1 and GP2

    • Identify conserved neutralizing epitopes across multiple arenaviruses

    • Design stabilized pre-fusion GPC immunogens

  • Novel antiviral strategies:

    • Target unique features like the stable signal peptide (SSP)

    • Develop entry inhibitors based on receptor-binding domain structure

    • Create broadly neutralizing antibodies targeting conserved GPC epitopes

  • Comparative studies across arenavirus species:

    • Investigate determinants of receptor specificity

    • Identify conserved and species-specific fusion mechanisms

    • Develop pan-arenavirus countermeasures

  • Improved animal models:

    • Develop small animal models susceptible to Parana virus

    • Create humanized mouse models expressing relevant receptors

    • Establish challenge models for vaccine evaluation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.