Recombinant Parvibaculum lavamentivorans ATP synthase subunit b 2 (atpF2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; Plav_0695; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Target Names
atpF2
Target Protein Sequence
MIAEAMAQEPGSELISETQVPDAEHAGGFPPFDAASFESQLVWLVLSFAALYLLMSRVAL PRIANVLEERRDRIADDLDQAAQFQLQTEEAIGAYEKALAEARAKAQGIAQETRDRLQEE TERQRLAIEARLAEKISEAEKQIAATKDAALQNVRAVAVDVADTIVAQLLGDSDRSATER AVDTELS
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) and F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of ATP synthase subunit b 2 (atpF2) in Parvibaculum lavamentivorans?

ATP synthase subunit b 2 (atpF2) is part of the F₀ sector of the bacterial ATP synthase complex, facilitating proton translocation across the membrane. In Parvibaculum lavamentivorans, this subunit interacts with subunit a and the c-ring to form the proton-conducting pathway. Its transmembrane α-helices (e.g., residues Tyr 13 and Gly 188) mediate critical interactions with subunit a, enabling proton flow during ATP synthesis . Structural studies of related bacterial ATP synthases (e.g., Bacillus PS3) reveal that subunit b 2 stabilizes the c-ring and modulates rotational dynamics during proton-driven ATP production .

Key Structural Features

FeatureDescription
Transmembrane domainsTwo α-helices spanning the lipid bilayer, interacting with subunit a
Peripheral stalkConnects F₀ to F₁ regions, enabling energy transfer during rotation
Proton translocationForms part of the periplasmic and cytoplasmic half-channels in F₀

How is the recombinant atpF2 protein expressed and purified for biochemical studies?

Recombinant atpF2 from Parvibaculum lavamentivorans is typically expressed in E. coli as a His-tagged fusion protein. Purification involves affinity chromatography (e.g., Ni²⁺-NTA columns), followed by size-exclusion chromatography to ensure monodispersity. The protein is stored in Tris-based buffer with 50% glycerol at -20°C to preserve stability .

Optimized Protocol

  • Expression: Induce with IPTG at 16–18°C to prevent inclusion body formation.

  • Lysis: Use high-pressure homogenization or sonication in buffer with 0.5% Triton X-100.

  • Purification:

    • Ni²⁺-NTA affinity chromatography (20 mM Tris, 300 mM NaCl, 10 mM imidazole).

    • Elution with 250 mM imidazole.

  • Quality Control: Verify purity via SDS-PAGE and confirm activity in ATP synthase reconstitution assays .

What challenges arise in studying ATP synthase subunit b 2 in isolation versus in the intact complex?

Studying atpF2 in isolation limits understanding of its dynamic interactions with subunit a and the c-ring. For example, cryo-EM structures of intact Bacillus PS3 ATP synthase reveal that subunit b 2’s soluble region adopts distinct conformations during rotation, which are lost in isolated subunit studies .

Comparative Challenges

AspectIsolated SubunitIntact Complex
Conformational dynamicsStatic structuresRotational states captured
Proton translocationHypothetical pathwayDirect observation of half-channels
Functional assaysLimited to binding studiesATP synthesis/hydrolysis activity

How does subunit b 2 (atpF2) contribute to ATP synthase inhibition or activation in different metabolic states?

In Bacillus PS3, subunit " (a regulatory subunit) interacts with atpF2 to inhibit ATP hydrolysis when ATP levels are low. This mechanism prevents energy waste but allows ATP synthesis when proton motive force is present. Mutagenesis studies in E. coli suggest that subunit b 2’s N-terminal residues (e.g., Tyr 13) stabilize subunit a’s interaction with the c-ring, modulating rotational efficiency .

Regulatory Mechanisms

  • Inhibition: Subunit " blocks ATP hydrolysis by clashing with the bTP subunit in F₁ .

  • Activation: High ATP concentrations (>1 mM) shift subunit " to a permissive conformation, enabling bidirectional rotation .

What methodologies are employed to analyze atpF2’s role in proton translocation?

To study proton translocation, researchers use:

  • Cryo-EM: Captures rotational states of the intact complex, revealing proton pathways .

  • Site-directed mutagenesis: Targets conserved residues (e.g., Arg 169 in subunit a) to disrupt proton release .

  • Patch-clamp electrophysiology: Measures proton flux in reconstituted liposomes.

Experimental Design for Proton Translocation

TechniqueApplicationLimitations
Cryo-EMStructural snapshots of proton channelsStatic, no real-time dynamics
MutagenesisFunctional importance of residuesOverlook compensatory pathways
Patch-clampQuantitative proton flux measurementsRequires purified complexes

How does the genomic context of Parvibaculum lavamentivorans inform its ATP synthase evolution?

The 3.9 Mb genome of P. lavamentivorans encodes 3,654 proteins, including surfactant-degrading enzymes and ATP synthase subunits. Its Alphaproteobacterial lineage (order Rhizobiales) shares ancestral ATP synthase genes with Bacillus PS3 and E. coli, but divergent residues in subunit b 2 (e.g., Gly 188 vs. Leu 229 in E. coli) reflect adaptation to distinct metabolic niches, such as detergent degradation .

Genomic Insights

  • Synteny: ATP synthase operon structure resembles Rhodobacterales but lacks subunit 8 (A6L in mitochondria) .

  • Codon bias: High ptAI values in GTA genes suggest selection for translational efficiency in nutrient-limited environments .

What are the challenges in reconstituting active ATP synthase complexes with recombinant atpF2?

Reconstituting active complexes requires precise subunit stoichiometry (e.g., a₃b₂c₁₀ in Bacillus PS3) and proper membrane integration. Challenges include:

  • Aggregation: Hydrophobic transmembrane domains of atpF2 may misfold.

  • Stability: Detergents (e.g., DDM) disrupt subunit interactions.

Reconstitution Protocol

  • Subunit preparation: Purify a, b, c, and γ subunits individually.

  • Assembly: Mix subunits in lipid bilayers (e.g., E. coli lipids) with chaperones (e.g., DnaK).

  • Validation: Test ATP synthesis using NADH-driven proton gradients .

How do structural differences between bacterial and mitochondrial ATP synthases impact atpF2’s functional role?

Bacterial ATP synthases lack subunit 8 (A6L) found in mitochondria, relying instead on extended loops in subunit a. These loops compensate for the absence of subunit 8, suggesting convergent evolution for proton translocation. In P. lavamentivorans, subunit b 2’s interaction with subunit a may be critical for stabilizing the c-ring in the absence of additional subunits .

Comparative Functional Roles

OrganismSubunit CompositionATP Synthase Complexity
Bacillus PS3a₃b₂c₁₀Minimalist, high efficiency
Saccharomyces cerevisiaea₃b₂c₁₀ + subunit 8Enhanced stability, torque

What are the implications of subunit b 2’s flexibility for ATP synthase regulation?

Subunit b 2’s soluble region exhibits conformational flexibility, enabling dynamic interactions with subunit " during rotational states. This flexibility allows the enzyme to toggle between ATP synthesis and hydrolysis without requiring major structural rearrangements. Mutations in flexible regions (e.g., poly-alanine stretches) may disrupt energy coupling .

Flexibility and Regulation

  • ATP synthesis: Subunit b 2’s movement enables counter-clockwise rotation.

  • ATP hydrolysis: Subunit " restricts clockwise rotation via steric clashes with bTP .

How can researchers address discrepancies in ATP synthase activity assays using recombinant atpF2?

Discrepancies often arise from:

  • Subunit misfolding: Use chaperones (e.g., GroEL) during expression.

  • Proton leakage: Optimize lipid composition (e.g., E. coli polar lipids) to reduce permeability.

  • Contaminants: Perform mass spectrometry to confirm subunit purity.

Troubleshooting Activity Assays

IssueDiagnostic ToolResolution
Low ATP synthesisBlue native PAGERe-purify subunits
High background activityATPase inhibitors (e.g., DCCD)Add to negative controls
Variable yieldsFluorescence-based proton assaysStandardize membrane preparation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.