Recombinant Parvibaculum lavamentivorans Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Plav_0712; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Target Names
mscL
Target Protein Sequence
MFKEFREFALKGNVLDMAVGIIIGAAFTTIVQSLVNDIIMPPVGVLMGGVDFTDYFIALT WSDVAPVSVDAAKEAGIPVIAYGRFINAVIQFAIVAFALFLVIRQMNRLKARIAKGEAPA PAAPPRQEVLLEEIRDALRAKG
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It is potentially involved in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Parvibaculum lavamentivorans and what is its significance in microbiology?

Parvibaculum lavamentivorans DS-1 is the type species of the genus Parvibaculum in the family Rhodobiaceae (formerly Phyllobacteriaceae) within the order Rhizobiales of Alphaproteobacteria. It is a Gram-negative, non-pigmented, aerobic, heterotrophic bacterium notable for its role in environmental microbiology. The organism was first isolated for its ability to degrade linear alkylbenzenesulfonate (LAS), which is a major laundry surfactant with global usage of approximately 2.5 million tons annually. This bacterium is considered environmentally significant as it represents the first tier member of bacterial communities that catalyze the complete degradation of synthetic laundry surfactants .

The bacterium has distinctive morphological characteristics, appearing as very small (approximately 1.0 × 0.2 μm), slightly curved rod-shaped cells that can be motile via a polar flagellum. It is a slow-growing organism that can be challenging to isolate and cultivate, forming pinpoint colonies after more than two weeks of incubation on complex media .

What is the mscL protein and what is its function in bacterial cells?

The Large-conductance mechanosensitive channel (mscL) is a protein that plays a crucial role in the osmotic regulation of bacterial cells. This channel opens in response to stretch forces in the lipid bilayer, allowing for the rapid release of cellular contents when bacteria experience hypoosmotic shock. Specifically, mscL functions as a "pressure-release valve" that prevents cell lysis by releasing solutes when membrane tension becomes too high .

Structurally, the mscL protein forms a homopentamer with each subunit containing two transmembrane regions. The channel gates via a bilayer mechanism that is triggered by hydrophobic mismatch and changes in membrane curvature and/or transbilayer pressure profile. During stationary phase and osmotic shock conditions, the expression of the mscL protein is upregulated to enhance the cell's ability to prevent lysis .

How is recombinant P. lavamentivorans mscL typically expressed and purified?

Recombinant P. lavamentivorans mscL is typically expressed in E. coli expression systems using standard molecular biology techniques. The most common approach involves:

  • Cloning: The mscL gene (Plav_0712) is amplified from P. lavamentivorans genomic DNA and inserted into an appropriate expression vector containing an N-terminal His-tag for purification purposes.

  • Expression: The recombinant plasmid is transformed into E. coli expression strains optimized for membrane protein production. Expression is typically induced using IPTG or other inducers depending on the vector system .

  • Purification: After expression, cells are lysed and membrane fractions isolated. The protein is then solubilized using appropriate detergents and purified using affinity chromatography methods, most commonly Ni-NTA chromatography that exploits the His-tag. Further purification may involve size exclusion chromatography to obtain highly pure protein samples .

  • Final Preparation: The purified protein is often lyophilized for long-term storage, with a final product purity greater than 90% as determined by SDS-PAGE analysis .

What are the optimal storage conditions for recombinant P. lavamentivorans mscL protein?

For optimal stability and activity retention, recombinant P. lavamentivorans mscL protein should be stored according to the following guidelines:

  • Short-term storage: For working aliquots, store at 4°C for up to one week .

  • Long-term storage: Store at -20°C or -80°C. The lyophilized form is preferred for extended storage periods .

  • Storage buffer: The protein is typically stored in a Tris-based buffer with 50% glycerol to prevent freeze-thaw damage. The buffer is optimized for the specific protein preparation, typically maintaining a pH of around 8.0 .

  • Reconstitution: When using lyophilized protein, it should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended for aliquoting and long-term storage .

  • Avoiding degradation: Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. It is recommended to briefly centrifuge vials prior to opening to bring contents to the bottom of the tube .

What experimental approaches can be used to study the gating mechanism of P. lavamentivorans mscL?

Investigating the gating mechanism of P. lavamentivorans mscL requires sophisticated biophysical and molecular biology techniques:

  • Patch-clamp electrophysiology: This technique allows direct measurement of channel conductance and gating properties. By applying defined membrane tension through negative pressure in the patch pipette, researchers can determine the tension threshold required for channel opening and characterize conductance states. This approach can reveal how membrane tension translates into conformational changes of the channel protein.

  • Reconstitution in liposomes: Purified mscL can be reconstituted into artificial liposome systems with controlled lipid composition. Techniques such as stopped-flow spectrofluorimetry with fluorescent dyes can then monitor solute efflux upon application of osmotic downshock, providing insights into channel activation in a defined membrane environment.

  • Site-directed mutagenesis: Specific amino acid residues can be mutated to investigate their role in channel gating. By comparing the electrophysiological properties of wild-type and mutant channels, researchers can identify residues critical for sensing membrane tension and for the conformational changes that lead to channel opening.

  • Molecular dynamics simulations: Computational approaches can model how membrane tension affects the conformation of the mscL channel. These simulations can predict structural changes and identify key interactions that stabilize open and closed states, guiding experimental verification.

  • Voltage-clamp fluorometry: This technique combines electrophysiological recording with fluorescence measurements by labeling specific residues with environment-sensitive fluorophores. This allows real-time correlation between structural changes (detected by fluorescence changes) and functional states of the channel (detected by current measurements).

How does the amino acid sequence of P. lavamentivorans mscL compare to other bacterial mechanosensitive channels?

Comparative sequence analysis of P. lavamentivorans mscL reveals important insights about evolutionary conservation and functional domains:

Bacterial SpeciesSequence Identity (%)Transmembrane DomainsTotal Length (aa)Key Conserved Motifs
P. lavamentivorans100 (reference)2142IIIGA motif in TM1
E. coli MscL~40-45 (estimated)2136IIIGA motif in TM1
M. tuberculosis MscL~35-40 (estimated)2151IIIGA motif in TM1
S. aureus MscL~30-35 (estimated)2120-130IIIGA motif in TM1

The P. lavamentivorans mscL shares several conserved structural features with other bacterial mscL proteins, including the signature pentameric assembly with two transmembrane domains per subunit. The protein likely follows the general structural pattern observed in other bacterial mscL channels, which consists of:

  • N-terminal domain: Involved in channel gating

  • First transmembrane domain (TM1): Forms the channel pore lining

  • Periplasmic loop: Connects the transmembrane domains

  • Second transmembrane domain (TM2): Interacts with the membrane

  • C-terminal cytoplasmic helical bundle: Stabilizes the closed state

Despite these similarities, P. lavamentivorans mscL likely possesses unique sequence adaptations that may reflect its specialized environmental niche and the specific membrane properties of this bacterium .

What electrophysiological techniques are most suitable for characterizing the conductance properties of P. lavamentivorans mscL?

Several electrophysiological approaches can be employed to characterize the conductance properties of P. lavamentivorans mscL:

  • Patch-clamp in reconstituted systems:

    • Spheroplast patch-clamp: Bacterial cells are treated with lysozyme to remove the cell wall, creating spheroplasts suitable for patch-clamp recording.

    • Giant E. coli spheroplast expression system: The mscL gene can be expressed in E. coli, which are then converted to giant spheroplasts for more accessible patch-clamp analysis.

    • Liposome patch-clamp: Purified mscL protein is reconstituted into liposomes, which are then used for patch-clamp measurements.

  • Planar lipid bilayer recordings: This technique involves creating an artificial lipid bilayer across a small aperture and incorporating the purified channel protein. It allows for precise control of the lipid composition and solution environments on both sides of the membrane.

  • Pressure-clamp spectroscopy: Combines traditional patch-clamp with precise pressure control systems to apply defined membrane tension while recording channel activity. This allows for detailed analysis of pressure-conductance relationships.

  • Single-channel analysis: These recordings can determine:

    • Unitary conductance: Typically exceeding 3 nS for mscL (which gives it the "large conductance" designation)

    • Subconductance states during gating transitions

    • Dwell times in open and closed states

    • Tension dependence of gating kinetics

  • Noise analysis: Fluctuation analysis of macroscopic currents can provide information about channel kinetics and conductance that may not be resolvable in direct recordings.

The exceptionally large conductance of mscL channels (typically 3-3.5 nS in 200-300 mM KCl) provides a distinctive electrophysiological signature that can be readily distinguished from other channel types .

How does the lipid environment affect the function of reconstituted P. lavamentivorans mscL?

The lipid environment significantly impacts the function of mechanosensitive channels like P. lavamentivorans mscL through several mechanisms:

  • Hydrophobic matching: The hydrophobic thickness of the lipid bilayer must match the hydrophobic region of the transmembrane domains. Mismatches can create tension that affects channel gating. Researchers can systematically vary the acyl chain length of phospholipids in reconstitution experiments to assess this effect.

  • Membrane fluidity: More fluid membranes generally facilitate mscL gating at lower tension thresholds. This can be studied by incorporating different ratios of saturated and unsaturated phospholipids into reconstitution systems.

  • Lipid headgroup composition:

    • Negatively charged lipids (like phosphatidylglycerol) can influence channel function through electrostatic interactions with charged residues of the protein.

    • Lipids with different spontaneous curvatures can affect the energy required for channel opening.

  • Cholesterol and other membrane-modifying components: These can alter membrane mechanical properties and affect the tension threshold required for channel activation.

  • Methodological approaches to study lipid effects:

    • Defined liposome systems: Reconstituting mscL into liposomes with precisely controlled lipid composition allows systematic investigation of specific lipid effects.

    • Fluorescence assays: Using fluorescent dyes trapped in liposomes to monitor channel opening in response to osmotic downshock in different lipid environments.

    • Patch-clamp of reconstituted channels: Directly measuring channel activity in membranes of defined composition.

    • EPR spectroscopy: Spin-labeled lipids can provide information about lipid-protein interactions and local membrane properties around the channel.

Understanding these lipid-protein interactions is crucial for interpreting the physiological function of mscL in P. lavamentivorans' native membrane environment and for optimizing experimental conditions in structural and functional studies .

What crystallization strategies can be employed for structural determination of P. lavamentivorans mscL?

Obtaining high-resolution structural information for membrane proteins like P. lavamentivorans mscL presents significant challenges. Several strategies can enhance success:

  • Detergent screening: Systematic evaluation of various detergents for protein extraction and crystallization is crucial. Commonly used detergents include:

    • n-Dodecyl-β-D-maltoside (DDM)

    • n-Octyl-β-D-glucopyranoside (OG)

    • Lauryldimethylamine oxide (LDAO)

    • Digitonin

  • Protein engineering approaches:

    • Thermostabilizing mutations: Identify and introduce mutations that enhance protein stability without affecting native structure.

    • Fusion partners: Insert well-crystallizing proteins (T4 lysozyme, BRIL) into loops to provide crystal contact points.

    • Antibody fragment complexation: Co-crystallize with Fab or nanobody fragments that bind specifically to the protein, providing additional crystal contacts.

  • Lipidic cubic phase (LCP) crystallization: This method provides a more native-like environment for membrane proteins and has been successful for many challenging membrane protein structures. The protein is reconstituted into a lipidic mesophase prior to crystallization trials.

  • Vapor diffusion methods: Both hanging drop and sitting drop methods with specialized screening conditions for membrane proteins can be employed.

  • Alternative structural biology approaches:

    • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein structure determination without the need for crystals.

    • Solid-state NMR: Can provide structural information on membrane proteins in lipid environments.

  • Crystal optimization strategies:

    • Additive screening

    • Controlled dehydration

    • Seeding techniques

    • Temperature optimization

    • pH and precipitant fine-tuning

For P. lavamentivorans mscL specifically, initial trials might focus on conditions that have been successful for other mechanosensitive channel proteins, while systematically exploring modifications to account for its unique properties.

What is the role of P. lavamentivorans mscL in osmotic stress response, and how can it be studied?

The mscL protein plays a critical role in protecting P. lavamentivorans from osmotic downshock by acting as an emergency release valve. When bacteria experience a sudden decrease in external osmolarity, water rushes into the cell, increasing turgor pressure and membrane tension. This activates mechanosensitive channels like mscL, which release osmolytes and reduce internal pressure, preventing cell lysis .

Key methodological approaches to study this osmotic stress response include:

  • Growth and survival assays:

    • Comparing survival rates of wild-type vs. mscL deletion strains during osmotic downshock

    • Measuring growth recovery after osmotic stress in various genetic backgrounds

    • Complementation studies to confirm phenotypes are specifically due to mscL function

  • Real-time monitoring of cellular responses:

    • Fluorescent reporter assays to track cellular volume changes during osmotic shifts

    • FRET-based sensors to detect conformational changes in mscL during osmotic stress

    • Time-lapse microscopy to observe morphological changes in individual cells

  • Gene expression analysis:

    • RT-qPCR to quantify mscL expression under different osmotic conditions

    • Transcriptome analysis to identify genes co-regulated with mscL during stress

    • Promoter-reporter fusions to visualize when and where mscL is expressed

  • Solute efflux measurements:

    • Radioactive tracer release assays to quantify small molecule efflux during hypoosmotic shock

    • HPLC analysis of released osmolytes to determine channel selectivity

    • Patch-clamp measurements of osmotically activated currents

  • In vivo protein dynamics:

    • Fluorescently tagged mscL to track localization during osmotic stress

    • FRAP (Fluorescence Recovery After Photobleaching) to assess membrane mobility during stress

    • Cross-linking studies to capture transient protein-protein interactions during osmotic response

Since P. lavamentivorans was isolated from environments where it degrades surfactants, the interplay between its unique ecological niche and osmotic stress responses presents an interesting research direction. The mscL channel may have evolved specific properties to handle membrane perturbations caused by both osmotic shifts and the surfactants this bacterium metabolizes .

How can site-directed mutagenesis be used to investigate the function of specific domains in P. lavamentivorans mscL?

Site-directed mutagenesis offers powerful approaches to dissect structure-function relationships in P. lavamentivorans mscL:

  • Strategic mutation design based on predicted functional domains:

    • Pore-lining residues: Mutations in the first transmembrane domain (TM1) that likely lines the channel pore can alter conductance, ion selectivity, and gating properties.

    • Tension-sensing regions: Mutations at the lipid-protein interface can modify the tension threshold required for channel opening.

    • Gate residues: Targeted mutations at constriction points can create "leaky" channels or channels that require higher tension to open.

    • Intersubunit interfaces: Mutations affecting subunit interactions can reveal assembly determinants and cooperative gating mechanisms.

  • Types of mutations to consider:

    • Alanine scanning: Systematic replacement of residues with alanine to identify functionally important positions.

    • Conservative substitutions: Replacing residues with similar amino acids to probe subtle functional effects.

    • Charge reversals or neutralizations: Changing charged residues to investigate electrostatic interactions.

    • Cysteine substitutions: Introducing cysteines for subsequent chemical modification or cross-linking studies.

    • Introduction of reporter groups: Inserting residues that can be labeled with fluorescent or spectroscopic probes.

  • Methodological approach:

    • Generate mutations using PCR-based site-directed mutagenesis

    • Express wild-type and mutant proteins in parallel under identical conditions

    • Perform comparative functional assays:

      • Electrophysiological characterization

      • Osmotic downshock survival tests

      • Solute release measurements

      • Structural studies

  • Specific targets for P. lavamentivorans mscL mutagenesis:

    • The conserved "IIIGA" motif in TM1, which is likely critical for channel gating

    • The glycine residues in transmembrane domains that may serve as molecular hinges during gating

    • Charged residues at the cytoplasmic and periplasmic ends of transmembrane domains

    • C-terminal region residues that may be involved in tension sensing or channel stabilization

Through systematic mutagenesis and functional characterization, researchers can develop detailed molecular models of how P. lavamentivorans mscL senses and responds to membrane tension, potentially revealing unique adaptations related to this bacterium's environmental niche .

What are the potential applications of P. lavamentivorans mscL in biotechnology and drug discovery?

P. lavamentivorans mscL offers several promising applications in biotechnology and pharmaceutical research:

  • Antimicrobial drug development:

    • The mscL channel represents a potential target for novel antibiotics, especially against multiple drug-resistant bacterial strains .

    • Engineering compounds that inappropriately activate the channel could cause cellular content leakage and bacterial death.

    • High-throughput screening systems using fluorescent indicators can identify molecules that modulate channel activity.

  • Biosensor development:

    • Engineered mscL variants can serve as sensitive detectors for membrane-active compounds.

    • The channel can be modified to respond to specific stimuli beyond mechanical tension.

    • Coupling channel opening to reporter systems enables detection of membrane-perturbing agents.

  • Controlled release systems:

    • Liposomes incorporating engineered mscL variants can release encapsulated contents in response to specific triggers.

    • Applications include targeted drug delivery and smart material development.

    • The large conductance of mscL allows release of a wide range of molecule sizes.

  • Model system for membrane protein research:

    • The relatively simple structure and robust expression make mscL an excellent model for studying membrane protein folding, stability, and function.

    • Insights gained can inform the study of more complex membrane proteins.

  • Structural biology platform:

    • P. lavamentivorans mscL can serve as a scaffold for protein engineering approaches in structural biology.

    • The pentameric structure provides opportunities for symmetrical modifications and multivalent display.

  • Environmental biotechnology:

    • Given P. lavamentivorans' role in surfactant degradation, its mscL may have evolved unique properties that could be harnessed for bioremediation applications .

    • Understanding how this channel functions in detergent-rich environments could inspire the development of robust membrane proteins for industrial processes.

These applications leverage both the fundamental properties of mechanosensitive channels and the potentially unique adaptations of the P. lavamentivorans variant, which evolved in a bacterium specialized for surfactant degradation in challenging environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.