Recombinant Parvibaculum lavamentivorans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Origin and Taxonomic Context

To properly understand the significance of the recombinant nuoK protein, it is essential to consider its biological source. Parvibaculum lavamentivorans DS-1 is the type species of the genus Parvibaculum within the family Rhodobiaceae (formerly classified under Phyllobacteriaceae) in the order Rhizobiales of Alphaproteobacteria. This bacterium was isolated from activated sludge in an industrial sewage treatment plant in Germany.

P. lavamentivorans has gained scientific attention due to its remarkable ability to degrade a wide range of synthetic laundry surfactants, including linear alkylbenzenesulfonate (LAS), which is produced worldwide at approximately 2.5 million tons annually. The bacterium plays a crucial ecological role as a "first-tier" member of bacterial communities that completely degrade these surfactants in wastewater treatment systems.

The complete genome of P. lavamentivorans DS-1 has been sequenced, revealing a 3,914,745 base pair genome with 3,654 protein-coding genes. The nuoK gene has been identified with the locus tag Plav_3216 within this genome.

Function of NADH-quinone oxidoreductase subunit K

NADH-quinone oxidoreductase (NDH-1) represents a crucial component of the bacterial respiratory chain, serving as the primary entry point for electrons into the electron transport system. This enzyme complex, similar to mitochondrial Complex I, catalyzes the transfer of electrons from NADH to quinones while simultaneously pumping protons across the membrane, contributing to the proton motive force necessary for ATP synthesis.

The nuoK subunit, as an integral membrane component of this complex, plays a structural role in the formation of the membrane domain. While the exact functional contributions of nuoK remain to be fully elucidated, comparative studies with similar subunits in other bacteria suggest its involvement in proton translocation and maintaining the structural integrity of the NADH-quinone oxidoreductase complex.

Production and Purification of Recombinant nuoK

The recombinant P. lavamentivorans NADH-quinone oxidoreductase subunit K is typically produced using heterologous expression systems. According to commercial product information, the recombinant protein is commonly expressed in Escherichia coli with affinity tags to facilitate purification. The expression systems are designed to optimize protein yield while maintaining proper folding and stability of this membrane protein.

Expression Systems

Several expression systems can be employed for the production of recombinant nuoK, including bacterial (E. coli), yeast, baculovirus, and mammalian cell systems. The choice of expression system depends on the specific requirements of the protein and its intended application. For structural studies and basic biochemical characterization, bacterial expression systems are often preferred due to their high yield and relative simplicity.

Research Applications

Recombinant P. lavamentivorans NADH-quinone oxidoreductase subunit K has several potential applications in biochemical and environmental research:

Immunological Research

Recombinant nuoK can serve as an antigen for:

  • Production of specific antibodies against this protein

  • Development of immunoassays for detection and quantification

  • Immunolocalization studies to determine subcellular distribution

Environmental Research

Given the ecological importance of P. lavamentivorans in surfactant degradation, studies involving its respiratory proteins may contribute to:

  • Understanding energy metabolism during surfactant biodegradation

  • Development of biomarkers for monitoring bacterial activity in wastewater treatment

  • Investigation of potential bioremediation applications

Several research methods incorporate recombinant P. lavamentivorans NADH-quinone oxidoreductase subunit K:

Enzyme-Linked Immunosorbent Assay (ELISA)

The recombinant protein can be utilized in ELISA-based detection systems for specific antibody development or for studying protein-protein interactions. Commercial preparations of the protein are specifically designed for such applications.

Reconstitution Studies

Purified recombinant nuoK can be reconstituted into artificial membrane systems (liposomes or nanodiscs) to study its biophysical properties and interactions with other components of the respiratory complex.

Ecological Context and Significance

The study of P. lavamentivorans nuoK takes on additional significance when considered within the ecological role of this organism. As a primary degrader of synthetic surfactants, P. lavamentivorans occupies an important niche in environmental microbial communities, particularly in wastewater treatment systems.

In enrichment cultures studying nitrate-dependent ferrous iron oxidation (NDFO), P. lavamentivorans has been identified as a heterotrophic nitrate-reducing bacterium, though it appears to play a secondary role to the primary iron oxidizers in the Gallionellaceae family. This suggests that P. lavamentivorans may participate in multiple biogeochemical processes beyond surfactant degradation.

The energy metabolism of this organism, including its respiratory chain components like nuoK, is therefore relevant to understanding how these bacteria function in complex environmental processes. The recombinant protein provides a tool for investigating these metabolic pathways under controlled laboratory conditions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; Plav_3216; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Target Names
nuoK
Target Protein Sequence
MAIGLEHYLTVAAILFTLGIFGIFLNRKNVIVILMSIELMLLAVNINLVAFSTHLGDLAG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDINMMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. This process couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Parvibaculum lavamentivorans and what makes its nuoK gene of interest to researchers?

Parvibaculum lavamentivorans DS-1 is the type species of the genus Parvibaculum within the family Rhodobiaceae (formerly classified under Phyllobacteriaceae) in the order Rhizobiales of Alphaproteobacteria . This non-pigmented, aerobic, heterotrophic bacterium is environmentally significant as the first tier member of bacterial communities that degrade synthetic laundry surfactants . P. lavamentivorans is a small rod-shaped bacterium (approximately 1.0 × 0.2 μm) that can be motile via a polar flagellum .

The nuoK gene encodes a subunit of NADH-quinone oxidoreductase (Complex I), which is central to energy metabolism. While specific research on P. lavamentivorans nuoK is limited, studies on homologous proteins such as the NuoK subunit in Escherichia coli (homologous to mitochondrial ND4L) indicate its critical role in the coupling mechanism of the respiratory chain . The conservation of this protein across diverse bacterial species makes P. lavamentivorans nuoK particularly valuable for comparative studies of respiratory complex evolution and function.

What is the genomic context of the nuoK gene in Parvibaculum lavamentivorans?

The complete genome of P. lavamentivorans DS-1 consists of a single circular chromosome of 3,914,745 bp with 62.33% GC content . The genome contains 3,654 protein-coding genes, with 2,723 assigned to putative functions while the remaining are annotated as hypothetical proteins . While the search results don't specifically mention the genomic location of nuoK, in most bacteria, the nuo genes are typically organized in an operon.

Based on knowledge of related bacterial systems, the nuoK gene in P. lavamentivorans would likely be part of the nuo operon encoding the various subunits of NADH-quinone oxidoreductase (Complex I). This operon organization facilitates coordinated expression of all components necessary for the assembly of functional Complex I. The complete genome sequence enables researchers to study the specific regulatory elements controlling nuoK expression and its coordination with other nuo genes.

How does the NADH-quinone oxidoreductase complex function in bacterial energy metabolism?

NADH-quinone oxidoreductase (Complex I) serves as the primary entry point for electrons into the respiratory chain, coupling NADH oxidation to proton translocation across the membrane. This process contributes to the generation of a proton motive force used for ATP synthesis . The complex typically consists of 14 subunits in bacteria, with NuoK (homologous to mitochondrial ND4L) being one of the membrane domain subunits involved in proton translocation.

The functional mechanism involves electron transfer from NADH to quinone, coupled with proton translocation across the membrane. Conserved acidic residues in membrane subunits, including glutamic acids in NuoK, are critical for this coupling mechanism . In related bacterial systems, mutations in these conserved residues lead to significant impairment of coupled electron transfer and loss of electrochemical gradient generation .

What are the key conserved residues in P. lavamentivorans NuoK and their predicted functional roles?

While specific data on P. lavamentivorans NuoK is not provided in the search results, insights can be drawn from studies on homologous proteins. In the E. coli NuoK (ND4L homologue), two highly conserved glutamic acid residues (Glu-36 and Glu-72) located within the membrane domain play critical roles in the coupling mechanism . Mutations in these residues, particularly the nearly perfectly conserved Glu-36, lead to severe impairment of coupled electron transfer and loss of electrochemical gradient generation .

Additionally, arginine residues predicted to be on the cytosolic side of the membrane are functionally important, with simultaneous mutation of two vicinal arginine residues on a cytosolic loop causing severe impairment of coupled activities . These conserved residues likely participate in proton translocation pathways or maintain structural conformations essential for energy coupling.

Based on the high conservation of these functional elements across bacterial species, it is reasonable to predict that P. lavamentivorans NuoK contains similar critical residues. Sequence alignment and structural modeling would be necessary to precisely identify these residues and predict their arrangement within the membrane domain.

How might the unique metabolic capabilities of P. lavamentivorans influence the function or regulation of its respiratory complexes including NuoK?

P. lavamentivorans possesses remarkable metabolic versatility, particularly in degrading surfactants such as linear alkylbenzenesulfonate (LAS) . The organism can catalyze the omega-oxygenation of LAS and shorten the alkyl-chain through beta-oxidation, excreting short-chain degradation intermediates that are then utilized by other bacteria in the community .

This metabolic specialization may influence the function or regulation of respiratory complexes in several ways:

  • Energy demands during surfactant degradation might require specific adaptations in the respiratory chain, potentially including modified regulation or efficiency of the NADH-quinone oxidoreductase complex.

  • The bacteria forms biofilms during LAS utilization but remains planktonic when growing on substrates like acetate or octane . This lifestyle switch likely involves changes in energy metabolism that could affect the expression or assembly of respiratory complexes.

  • The diverse electron sources from different carbon substrates might necessitate flexibility in the electron transport chain, potentially reflected in structural or regulatory adaptations of the NuoK subunit.

Understanding how these metabolic specializations influence respiratory complex function could provide insights into the adaptation of energy generation systems to specific ecological niches.

What structural features distinguish P. lavamentivorans NuoK from its homologues in other bacterial species?

  • Sequence alignment of P. lavamentivorans NuoK with homologues from other bacteria would reveal unique substitutions or insertions/deletions that might confer species-specific properties.

  • Hydrophobicity analysis could identify potential differences in membrane-spanning regions that might affect proton translocation pathways or interactions with other subunits.

  • Analysis of the genomic context of nuoK might reveal species-specific regulatory elements or operon organization that influence expression patterns.

  • Evolutionary analysis comparing NuoK sequences across the Rhodobiaceae family and beyond could identify lineage-specific adaptations and selection pressures.

These approaches would help identify structural features potentially linked to the unique ecological niche of P. lavamentivorans as a surfactant-degrading specialist.

What are the optimal expression systems and purification strategies for recombinant P. lavamentivorans NuoK?

Expressing and purifying membrane proteins like NuoK presents significant challenges that require tailored approaches:

Expression Systems:

  • E. coli-based systems (BL21(DE3), C41(DE3), C43(DE3)) specifically designed for membrane protein expression

  • Homologous expression in P. lavamentivorans or closely related Alphaproteobacteria

  • Cell-free expression systems which can incorporate detergents or lipids during synthesis

Expression Optimization Parameters:

ParameterRange to TestConsiderations
Induction temperature16-30°CLower temperatures often improve folding
Inducer concentration0.1-1.0 mM IPTGTitration to find optimal level
Growth mediaLB, TB, minimal mediaMedia composition affects membrane composition
Induction OD₆₀₀0.4-1.0Cell density affects expression yield
Expression time4-24 hoursLonger times may lead to inclusion bodies

Purification Strategies:

  • Affinity chromatography using carefully positioned tags (C-terminal often preferred for membrane proteins)

  • Detergent screening for optimal solubilization (mild detergents like DDM, LMNG or digitonin)

  • Lipid nanodisc or amphipol reconstitution for stabilization

  • Size exclusion chromatography for final purification and complex assembly analysis

When working with NuoK specifically, it may be advantageous to co-express multiple subunits of the nuo operon to facilitate proper folding and assembly, as isolation of individual membrane subunits often leads to instability.

What experimental approaches can be used to characterize the function of specific residues in P. lavamentivorans NuoK?

Multiple complementary approaches can be employed to characterize the functional roles of specific residues:

Site-Directed Mutagenesis:

  • Alanine-scanning mutagenesis of conserved residues (particularly glutamic acids and arginines)

  • Conservative substitutions to probe the importance of specific chemical properties

  • Introduction of mutations corresponding to those studied in model organisms like E. coli

Functional Assays:

  • NADH oxidation activity measured spectrophotometrically

  • Proton translocation assays using pH-sensitive dyes or electrodes

  • Membrane potential measurements using voltage-sensitive fluorescent probes

  • Quinone reduction kinetics to assess electron transfer capabilities

Structural Studies:

  • Crosslinking approaches to identify proximity relationships with other subunits

  • Hydrogen-deuterium exchange mass spectrometry to probe conformational dynamics

  • Cryo-electron microscopy of the assembled complex with and without inhibitors

  • EPR spectroscopy to analyze electron transfer pathways

In vivo Approaches:

  • Complementation studies in knockout strains

  • Growth phenotype analysis under different metabolic conditions

  • Membrane potential measurements in whole cells

These approaches should be integrated to build a comprehensive understanding of how specific residues contribute to NuoK function within the NADH-quinone oxidoreductase complex.

How can researchers effectively study the assembly of P. lavamentivorans NuoK into the complete NADH-quinone oxidoreductase complex?

The assembly of membrane protein complexes like NADH-quinone oxidoreductase involves coordinated incorporation of multiple subunits. Several approaches can be used to study this process:

In vivo Assembly Studies:

  • Sequential gene deletion and complementation studies

  • Pulse-chase labeling combined with immunoprecipitation to track assembly intermediates

  • Fluorescently tagged subunits for real-time visualization of assembly

  • Blue native PAGE of membrane fractions to identify assembly intermediates

Reconstitution Approaches:

  • Co-expression of multiple subunits with controlled stoichiometry

  • Cell-free expression systems with simultaneous or sequential addition of components

  • Stepwise reconstitution from purified subunits or subcomplexes

Analytical Methods for Assembly Assessment:

MethodInformation ProvidedTechnical Considerations
Blue Native PAGEComplex integrity, assembly intermediatesDetergent choice critical for complex stability
Size Exclusion ChromatographyComplex size, homogeneityCan be combined with multi-angle light scattering
Mass SpectrometrySubunit stoichiometry, interactionsNative MS requires specialized instrumentation
Cryo-EMStructural arrangement of subunitsSample homogeneity crucial for high-resolution
Fluorescence Correlation SpectroscopyAssembly kinetics, stoichiometryRequires fluorescent labeling of components

Functional Validation:

  • Activity assays at different stages of assembly

  • Proton pumping efficiency of reconstituted complexes

  • Inhibitor sensitivity profiles to confirm proper assembly

These approaches would help elucidate the assembly pathway of P. lavamentivorans NADH-quinone oxidoreductase and the specific role of NuoK in this process.

How does P. lavamentivorans NuoK compare to its homologues in other surfactant-degrading bacteria?

Comparative analysis of NuoK across surfactant-degrading bacteria would reveal adaptations potentially linked to this specialized metabolism. While specific data on P. lavamentivorans NuoK homologues in other surfactant-degraders is not provided in the search results, a methodological approach to this question would include:

  • Identification of surfactant-degrading bacterial species across different phylogenetic groups

  • Sequence retrieval and multiple sequence alignment of NuoK homologues

  • Phylogenetic analysis to identify convergent evolution patterns

  • Analysis of selection pressures on specific residues or domains

  • Correlation of sequence variations with specific surfactant degradation capabilities

Given P. lavamentivorans' role in degrading various surfactants , its energy generation systems may have adapted to efficiently utilize the metabolic intermediates of surfactant degradation. Comparative genomic and proteomic analyses could reveal whether other surfactant-degrading bacteria have undergone similar adaptations in their respiratory complexes.

What insights can be gained from comparing the nuoK gene regulation between P. lavamentivorans and other Alphaproteobacteria?

The regulation of respiratory chain components often reflects adaptations to specific ecological niches. Several approaches could yield insights into nuoK regulation:

  • Comparative analysis of promoter regions and transcription factor binding sites upstream of nuoK across Alphaproteobacteria

  • Transcriptomic analysis of P. lavamentivorans when grown on different carbon sources (surfactants vs. simple substrates like acetate) to identify condition-specific regulation

  • Comparison of nuo operon organization across Alphaproteobacteria to identify conservation or divergence in gene clustering

  • Analysis of small RNAs or other post-transcriptional regulatory mechanisms that might target nuoK mRNA

P. lavamentivorans forms biofilms during surfactant degradation but remains planktonic when growing on simpler substrates , suggesting significant metabolic reprogramming between these growth modes. This lifestyle switch likely involves changes in energy metabolism regulation that could be reflected in nuoK expression patterns.

How do the structural and functional properties of P. lavamentivorans NuoK relate to its evolutionary history within the Rhodobiaceae family?

P. lavamentivorans belongs to the family Rhodobiaceae, and its genome represents the first sequenced member of this family . This unique phylogenetic position provides an opportunity to study the evolution of respiratory complexes within this lineage:

  • Phylogenetic reconstruction of NuoK sequences across Alphaproteobacteria with special focus on the Rhodobiaceae family

  • Identification of Rhodobiaceae-specific sequence signatures in NuoK that might reflect family-specific adaptations

  • Comparative analysis of conservation patterns in functional residues identified in model organisms (e.g., the glutamic acid and arginine residues studied in E. coli NuoK)

  • Correlation of sequence changes with ecological niches and metabolic capabilities of different Rhodobiaceae members

This evolutionary perspective would help place the structural and functional features of P. lavamentivorans NuoK in their proper phylogenetic context, potentially revealing how respiratory complexes have adapted during the radiation of the Rhodobiaceae family.

What technological advances would facilitate better structural characterization of membrane proteins like P. lavamentivorans NuoK?

Membrane proteins like NuoK present significant challenges for structural biology, requiring innovative approaches:

  • Advanced cryo-electron microscopy techniques with improved detectors and processing algorithms could enable higher resolution structures of membrane protein complexes

  • Novel membrane mimetics beyond traditional detergents, such as nanodiscs with customized lipid compositions that better mimic the native P. lavamentivorans membrane environment

  • Integration of computational approaches including molecular dynamics simulations to model conformational changes during the catalytic cycle

  • Development of in situ structural techniques that can probe membrane protein organization in intact cells or native-like membrane environments

These technological developments would enhance our understanding of NuoK's structure-function relationships within the assembled respiratory complex.

How might understanding P. lavamentivorans NuoK contribute to broader research on bacterial adaptation to specialized metabolic niches?

P. lavamentivorans has adapted to utilize synthetic surfactants, compounds that have only been present in the environment for decades . This recent adaptation makes it an excellent model for studying how bacteria evolve to exploit new ecological niches:

  • Comparative studies of respiratory chain components across bacteria with specialized metabolisms could reveal common adaptation patterns

  • Investigation of how energy conservation mechanisms are optimized for different carbon sources

  • Analysis of co-evolution between metabolic pathways and energy-generating systems

  • Examination of how horizontal gene transfer might have contributed to the acquisition of specialized metabolic capabilities alongside adaptations in energy generation

These studies would contribute to our understanding of bacterial evolution and adaptation, particularly in response to anthropogenic compounds in the environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.