Recombinant Parvibaculum lavamentivorans Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet your needs.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kdpC; Plav_1015; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Target Names
kdpC
Target Protein Sequence
MESFIASIRLVAATMLICVAGYSAAVWAVGQVLMPGSAQGSLIAAADGKVIGSSQVAQNF TEPRYFWPRPSAVDYNGAGAGGSNKSPTSTDIADRARETVARYGATAENPLPAELAAASG AGLDPHISERGALYQAARVAQARGLPQAGVEALIHEHAFAPGAFLAPDRLVNVLELNLAL DRVETAG
Uniprot No.

Target Background

Function

The Recombinant Parvibaculum lavamentivorans Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Recombinant Parvibaculum lavamentivorans Potassium-transporting ATPase C chain (kdpC)?

Recombinant Parvibaculum lavamentivorans kdpC is a bioengineered protein derived from the bacterium Parvibaculum lavamentivorans. This protein subunit serves as a component of the high-affinity ATP-driven potassium transport system (Kdp system), which plays a critical role in bacterial osmoregulation and potassium homeostasis. The recombinant version is produced through heterologous expression in suitable host organisms, typically E. coli or yeast, and is purified for various research applications. The protein is cataloged with UniProt ID A7HRV5 and is encoded by the gene Plav_1015 located on the 3.9 Mb circular chromosome of P. lavamentivorans DS-1T.

What expression systems are optimal for recombinant kdpC production?

For successful expression of recombinant P. lavamentivorans kdpC, E. coli has been established as the preferred host system. When designing expression constructs, researchers should consider:

Expression ParameterRecommended Approach
Vector SystempET-based vectors with T7 promoter
Affinity TagN-terminal His-tag for simplified purification
Expression StrainBL21(DE3) or derivatives with reduced protease activity
Induction Conditions0.1-0.5 mM IPTG at OD600 of 0.6-0.8
Growth Temperature25-30°C post-induction to enhance solubility
Growth MediaLB or 2YT supplemented with appropriate antibiotics

The expression construct should be designed to include the full-length sequence (amino acids 1-187) for optimal structural integrity. Temperature modulation post-induction is particularly important as the transmembrane domain can cause aggregation at higher temperatures .

What purification strategies yield the highest purity of recombinant kdpC?

A multi-step purification protocol is recommended for obtaining high-purity recombinant kdpC:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices to capture His-tagged kdpC

  • Intermediate Purification: Ion exchange chromatography to remove contaminants with different charge properties

  • Polishing Step: Size exclusion chromatography to separate aggregates and obtain homogenous protein preparations

For membrane-associated forms of kdpC, detergent solubilization prior to purification is essential. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations just above their critical micelle concentration (CMC) help maintain protein stability while extracting it from membrane fractions.

How should experiments be designed to assess kdpC's role in potassium transport?

When designing experiments to investigate kdpC's role in potassium transport, researchers should implement a systematic approach that controls for various factors affecting transport function:

  • Baseline Establishment: Create a reconstituted system with purified KdpA, KdpB, and kdpC in proteoliposomes with defined lipid composition.

  • Functional Validation: Measure ATP hydrolysis rates coupled with potassium transport using radioisotope (⁴²K⁺) uptake assays or fluorescent potassium indicators.

  • Structure-Function Analysis: Introduce site-directed mutations in key residues of kdpC to assess their impact on KdpB ATPase activity.

  • Control Conditions: Include negative controls (liposomes without protein or with inactive protein variants) and positive controls (known functional P-type ATPases).

The experimental design should follow the five key steps outlined for rigorous scientific inquiry: defining variables clearly, formulating testable hypotheses, designing appropriate treatments, assigning subjects to groups systematically, and establishing reliable measurement methods for dependent variables .

What control variables should be considered in kdpC functional studies?

When conducting functional studies with recombinant kdpC, several extraneous variables must be controlled to ensure valid and reproducible results:

Variable CategorySpecific Controls
Protein-RelatedProtein concentration, purity (>90% by SDS-PAGE), proper folding verification
Buffer ConditionspH, ionic strength, presence of specific ions (especially K⁺, Mg²⁺)
Membrane EnvironmentLipid composition, membrane fluidity, cholesterol content
Assay ParametersTemperature, incubation time, presence of ATP or analogs
CofactorsPresence of required metal ions, absence of inhibitors

How can structural analysis of kdpC contribute to understanding P-type ATPases?

Structural analysis of kdpC provides valuable insights into the regulatory mechanisms of P-type ATPases, especially regarding how auxiliary subunits modulate catalytic activity. Advanced structural approaches include:

  • X-ray Crystallography: Determination of high-resolution structures of kdpC alone or in complex with KdpB to identify interaction interfaces.

  • Cryo-Electron Microscopy: Visualization of the entire Kdp complex to understand spatial arrangements and conformational changes during the transport cycle.

  • NMR Spectroscopy: Investigation of dynamic regions and solution-state behavior, particularly for soluble domains of kdpC.

  • Molecular Dynamics Simulations: Computational modeling of kdpC interactions with KdpB and the membrane environment to predict functional movements.

These structural studies can reveal how kdpC enhances ATP binding to KdpB and stabilizes specific conformational states during the catalytic cycle. Comparisons with other P-type ATPase regulatory subunits can highlight conserved mechanisms across this important class of membrane transporters.

What methodologies are suitable for investigating kdpC's regulatory mechanisms?

To investigate the regulatory mechanisms of kdpC, researchers should employ a multi-faceted experimental approach:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with KdpB under varying conditions

    • Surface plasmon resonance to determine binding kinetics

    • Crosslinking followed by mass spectrometry to identify interaction interfaces

  • Functional Regulation Analysis:

    • ATPase activity assays with reconstituted proteins at different kdpC:KdpB ratios

    • Potassium transport measurements in response to osmotic challenges

    • Patch-clamp electrophysiology of reconstituted Kdp complexes

  • Phosphorylation and Conformational Change Studies:

    • Site-directed fluorescence labeling to track conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Detection of phosphorylated intermediates during the transport cycle

These approaches should be designed with appropriate controls, following the self-controlled design principles to minimize bias in data interpretation .

How can researchers address solubility issues when working with recombinant kdpC?

Solubility challenges are common when working with membrane-associated proteins like kdpC. Effective strategies to overcome these issues include:

  • Expression Optimization:

    • Reduce expression temperature to 16-20°C during induction

    • Use lower inducer concentrations (0.1-0.2 mM IPTG)

    • Consider specialized expression strains (C41/C43) designed for membrane proteins

  • Construct Modification:

    • Engineer solubility-enhancing fusion partners (MBP, SUMO, or Trx)

    • Create truncated constructs removing the transmembrane domain for specific studies

    • Optimize codon usage for the expression host

  • Solubilization Approaches:

    • Screen detergent panels (ranging from harsh to mild) for optimal extraction

    • Implement detergent exchange during purification to improve stability

    • Consider amphipols or nanodiscs for maintaining native-like membrane environments

  • Buffer Optimization:

    • Incorporate osmolytes (glycerol, sucrose) at 5-10%

    • Test different pH conditions (range 6.5-8.5)

    • Include stabilizing additives such as arginine or glutamate

Implementing these strategies systematically, with proper controls for each modification, will help identify the optimal conditions for obtaining soluble, functional kdpC protein .

What approaches help verify proper folding and activity of purified kdpC preparations?

Verification of proper folding and functional activity of purified kdpC is essential before proceeding with detailed experiments. Recommended validation approaches include:

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Intrinsic tryptophan fluorescence to evaluate tertiary structure

    • Size exclusion chromatography with multi-angle light scattering to verify monodispersity

  • Functional Validation:

    • Co-purification assays with KdpB to confirm interaction capabilities

    • Enhancement of KdpB ATPase activity in reconstituted systems

    • Thermal shift assays to assess protein stability and ligand binding

  • Activity Correlation:

    • Compare activities across different purification batches

    • Establish minimum quality thresholds for experimental use

    • Correlate structural parameters with functional outcomes

Each validation step should include appropriate positive and negative controls, and researchers should establish clear acceptance criteria for protein quality before proceeding with complex experimental procedures .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.