Recombinant Parvibaculum lavamentivorans Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Research Findings

While the exact biochemical function of Parvibaculum htpX remains under investigation, homologs in other organisms provide insights:

  • Metalloprotease Activity: The EC 3.4.24.- classification suggests a role in peptide bond cleavage, potentially involving zinc-dependent catalysis .

  • Chromosomal Architecture: In archaea like Thermococcus kodakarensis, HtpX homologs (e.g., TK0471) regulate chromosome structure and transcriptional regulation .

  • SOS Response: While not directly linked in Parvibaculum, HtpX homologs in other bacteria may influence stress responses (e.g., SOS-induced vesiculation in Pseudomonas aeruginosa) .

Limitations: Current literature lacks direct functional studies on Parvibaculum htpX, necessitating further experimental validation.

Research Applications

The recombinant htpX protein is primarily used in:

ApplicationDetails
ELISA KitsEnzyme-linked immunosorbent assays for antibody detection
Structural StudiesAtomic force microscopy or cryo-EM to analyze DNA-binding interactions
Protein-Protein InteractionsAffinity chromatography or co-IP to map binding partners

Note: These proteins are labeled for research use only and are not approved for diagnostic purposes .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of our products is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please communicate it to us. We will prioritize developing the specified tag according to your needs.
Synonyms
htpX; Plav_1327; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Target Names
htpX
Target Protein Sequence
MNTVKTGMLLAAMTALFMGLGFLIGGPKGAMIAFFIAAAMNLFAYWNSDKMVLRMYKARQ VDETTAPNYVGIVRQLAQNAGIPMPATYIIDNPQPNAFATGRDPEHAAVAATTGLIKMLT PEELAGVMAHELSHIKNRDTLIMTVTATIAGAISMLANFALFFGGNRNNAGGLIGTLALA ILAPMAAALVQMAISRTREYSADAGGAEISGNPLWLASALQRIDEAARRAPNEAAEANPA TAHMFIINPLNGRGRDNLFSTHPATGNRIDALRRIAETMGSRSRPWG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Parvibaculum lavamentivorans Protease HtpX homolog and what are its basic properties?

Parvibaculum lavamentivorans Protease HtpX homolog (htpX) is a 287-amino acid protein (UniProt ID: A7HSR4) belonging to the M48 family zinc metalloproteinases. It is derived from Parvibaculum lavamentivorans, a bacterial species isolated from activated sludge in Germany that can metabolize linear alkylbenzenesulfonates and alkyldiphenyletherdisulfonate . The protein functions as a membrane protease, likely involved in the quality control of membrane proteins based on homology to similar proteases such as those found in E. coli . The full-length recombinant protein can be expressed in E. coli systems with fusion tags (commonly His-tag) to facilitate purification and experimental manipulation .

What is the taxonomic classification of Parvibaculum lavamentivorans?

Parvibaculum lavamentivorans has the following taxonomic classification:

Taxonomic LevelClassification
DomainBacteria
PhylumPseudomonadota
ClassAlphaproteobacteria
OrderHyphomicrobiales
FamilyParvibaculaceae
GenusParvibaculum
SpeciesP. lavamentivorans
Binomial nameParvibaculum lavamentivorans Schleheck et al. 2004
Type strainDS-1, DSM 13023, NCIMB 13966

This bacterium was first isolated from activated sludge in Germany and has notable capabilities in metabolizing surfactants, specifically linear alkylbenzenesulfonates .

What are the optimal storage conditions for recombinant Parvibaculum lavamentivorans Protease HtpX homolog?

For optimal storage of recombinant Parvibaculum lavamentivorans Protease HtpX homolog, the following conditions are recommended:

  • Long-term storage: Store at -20°C or -80°C in aliquots to prevent repeated freeze-thaw cycles

  • Buffer composition: Store in Tris-based buffer with 50% glycerol, pH 8.0

  • Working aliquots: Store at 4°C for up to one week

  • Reconstitution: If lyophilized, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Glycerol addition: Add glycerol to a final concentration of 50% for cryoprotection

It is strongly advised to avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of enzymatic activity. Centrifuging the vial briefly before opening is recommended to bring contents to the bottom .

What expression systems are suitable for producing recombinant Parvibaculum lavamentivorans Protease HtpX homolog?

E. coli is the most commonly employed expression system for recombinant Parvibaculum lavamentivorans Protease HtpX homolog production . When designing an expression system, researchers should consider:

  • Vector selection: Choose vectors with appropriate promoters for controlled expression

  • Fusion tags: His-tag is commonly used for affinity purification, typically placed at the N-terminus

  • Codon optimization: May be necessary for efficient expression in E. coli

  • Expression conditions: Optimize temperature, induction time, and inducer concentration

  • Purification strategy: Affinity chromatography using the His-tag is the primary purification method

The protein can be successfully expressed as a full-length construct (amino acids 1-287) with maintained structural integrity and potential enzymatic activity .

What is the predicted membrane topology of Parvibaculum lavamentivorans Protease HtpX homolog?

Based on sequence analysis and homology to related proteins like E. coli HtpX, Parvibaculum lavamentivorans Protease HtpX homolog likely contains multiple transmembrane segments. While the exact topology for this specific protein has not been definitively characterized in the provided search results, we can infer from related proteases that:

  • It likely contains multiple hydrophobic regions that serve as transmembrane segments

  • The active site is probably located within the membrane

  • It may contain intramembrane β hairpins near the catalytic center, similar to other S2P proteases

  • The protein likely adopts a specific orientation across the membrane to facilitate its proteolytic activity against membrane protein substrates

Experimental approaches such as cysteine accessibility methods, protease protection assays, or structural studies would be needed to definitively determine the membrane topology.

How does Parvibaculum lavamentivorans Protease HtpX homolog compare functionally to E. coli HtpX?

While specific functional comparisons between Parvibaculum lavamentivorans Protease HtpX homolog and E. coli HtpX are not explicitly detailed in the provided search results, we can make informed inferences based on homology:

  • Shared enzyme family: Both belong to the M48 family zinc metalloproteinases

  • Membrane localization: Both are integral membrane proteins

  • Functional role: Both likely participate in quality control of membrane proteins

  • Substrate specificity: May differ based on the specific physiological requirements of their respective organisms

  • Structural features: Likely share conserved catalytic residues and basic structural elements, including potential intramembrane β sheets near the active site

E. coli HtpX has been characterized as involved in proteolytic quality control of cytoplasmic membrane proteins, and by homology, the Parvibaculum lavamentivorans protein likely serves a similar function in its native organism .

What assay systems are available for measuring Parvibaculum lavamentivorans Protease HtpX homolog activity?

While the search results don't provide specific assays for Parvibaculum lavamentivorans Protease HtpX homolog activity, researchers can adapt assays developed for homologous proteins such as E. coli HtpX. A notable example is an in vivo semiquantitative protease activity assay system:

  • Model substrate construction: Involves creating a specifically designed fusion protein that can serve as a substrate for the protease

  • In vivo assay: Allows detection of protease activity within living cells

  • Sensitivity: Enables detection of differential protease activities between wild-type and mutant variants

  • Cleavage detection: Typically involves immunoblotting to detect cleavage products

  • Quantification: Analysis of substrate and product bands allows semiquantitative assessment of protease activity

This type of assay would need to be adapted for the specific characteristics of Parvibaculum lavamentivorans Protease HtpX homolog, potentially requiring optimization of substrate sequence and experimental conditions.

How can site-directed mutagenesis be used to study the catalytic mechanism of Parvibaculum lavamentivorans Protease HtpX homolog?

Site-directed mutagenesis is a powerful approach for investigating the catalytic mechanism of proteases like Parvibaculum lavamentivorans Protease HtpX homolog. A methodological approach would include:

  • Identification of putative catalytic residues: Based on sequence alignment with characterized M48 metalloproteases and structural predictions

  • Design of mutations:

    • Conservative mutations (e.g., His→Asn, Glu→Gln) to probe catalytic roles

    • Alanine-scanning mutagenesis to identify essential residues

    • Cysteine mutations for accessibility and crosslinking studies

  • Expression and purification: Produce wild-type and mutant proteins under identical conditions

  • Activity assays: Compare activities using established protease assays

  • Structural analysis: Consider combining with structural studies to correlate functional changes with structural perturbations

This approach can reveal the roles of specific amino acids in substrate binding, catalysis, and structural integrity of the protease.

What is the potential role of intramembrane β hairpins in substrate recognition by Parvibaculum lavamentivorans Protease HtpX homolog?

Intramembrane β hairpins likely play a crucial role in substrate recognition and processing by Parvibaculum lavamentivorans Protease HtpX homolog, similar to other site-2 proteases (S2Ps). Based on structural studies of related proteases:

  • Proximity to active site: Intramembrane β hairpins are typically located near the catalytic center in the transmembrane domain

  • Substrate binding: These structures likely bind the substrate near the bond that is cleaved

  • Discrimination function: They contribute to substrate discrimination by recognizing specific structural features

  • Structural organization: The β sheet in the proximity of the active center appears to be a common feature in S2P family proteases

  • Experimental approach: Mutations in predicted β hairpins followed by activity assays can reveal their importance in substrate processing

The specific arrangement of these β hairpins may be critical for determining which proteins are recognized and cleaved by the protease.

How can structural analysis inform the development of specific inhibitors for Parvibaculum lavamentivorans Protease HtpX homolog?

Structural analysis of Parvibaculum lavamentivorans Protease HtpX homolog can guide rational inhibitor design through the following methodology:

  • Structural determination:

    • X-ray crystallography of the protein, potentially in complex with peptide-mimetic inhibitors

    • Cryo-electron microscopy for membrane-embedded protein structure

    • Homology modeling based on related proteins with known structures

  • Active site mapping:

    • Identification of catalytic residues

    • Characterization of substrate binding pockets

    • Analysis of access pathways to the active site

  • Rational inhibitor design:

    • Structure-based design of compounds that target the active site

    • Development of allosteric inhibitors that bind regulatory sites

    • Peptidomimetic approaches based on substrate recognition sequences

  • Iterative optimization:

    • Testing candidate inhibitors

    • Structural analysis of enzyme-inhibitor complexes

    • Refinement of inhibitor structures for improved potency and selectivity

Such approaches have been successfully employed for other proteases and could be adapted for the specific structural features of Parvibaculum lavamentivorans Protease HtpX homolog.

What methodologies are available to study the potential domain rearrangements during substrate accommodation by Parvibaculum lavamentivorans Protease HtpX homolog?

Several sophisticated methodologies can be employed to investigate domain rearrangements during substrate accommodation:

  • Comparative structural analysis:

    • Crystallization under different conditions

    • Comparison with orthologs to identify flexible regions

    • Analysis of structural differences that may indicate domain mobility

  • Dynamic structural techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with different solvent accessibility

    • Single-molecule FRET to measure distances between domains in real-time

    • NMR relaxation experiments to characterize domain dynamics

  • Computational approaches:

    • Molecular dynamics simulations to model conformational changes

    • Normal mode analysis to identify potential domain movements

    • Modeling of substrate binding and associated conformational changes

  • Biochemical approaches:

    • Disulfide crosslinking to restrict domain movements

    • Protease sensitivity assays to identify exposed regions

    • Site-directed spin labeling coupled with EPR spectroscopy

These methodologies could reveal how the protein might undergo conformational changes during substrate binding, accommodation, and proteolytic processing.

How does research on Parvibaculum lavamentivorans Protease HtpX homolog contribute to understanding intramembrane proteolysis mechanisms?

Research on Parvibaculum lavamentivorans Protease HtpX homolog can significantly advance our understanding of intramembrane proteolysis mechanisms through:

  • Comparative analysis: Studying this protein alongside other S2P family members can reveal conserved mechanisms across species

  • Substrate specificity: Elucidating how this protease recognizes and accommodates substrates can inform general principles of intramembrane proteolysis

  • Structural insights: Structural studies can reveal how proteolytic activity occurs within the hydrophobic environment of the membrane

  • Sequential cleavage understanding: Investigation may shed light on how substrate accommodation and cleavage are coordinated

  • Evolutionary perspective: Comparison with other bacterial proteases can provide insights into the evolution of membrane proteolysis mechanisms

This research has implications beyond the specific protein, potentially informing our understanding of similar processes in eukaryotic systems and disease-related proteolytic processes.

What are the challenges in reproducing native membrane environments for functional studies of Parvibaculum lavamentivorans Protease HtpX homolog?

Studying membrane proteases like Parvibaculum lavamentivorans Protease HtpX homolog presents unique challenges in recreating native membrane environments:

  • Membrane mimetics selection:

    • Detergent micelles: Simple but may not replicate native lipid interactions

    • Liposomes: Better mimic natural membranes but challenging for structural studies

    • Nanodiscs: Provide native-like environment with defined size

    • Bicelles: Useful for structural studies while maintaining membrane character

  • Lipid composition effects:

    • Specific lipid requirements for activity

    • Influence of membrane thickness on protein orientation

    • Charge distribution and its effect on substrate interaction

  • Reconstitution protocols:

    • Maintaining protein stability during purification and reconstitution

    • Achieving correct orientation in artificial membranes

    • Verifying functional integrity post-reconstitution

  • Assay compatibility:

    • Developing activity assays compatible with membrane systems

    • Distinguishing specific from non-specific proteolysis

    • Quantifying activity in heterogeneous systems

  • Experimental workflow:

    • Expression in a suitable host system

    • Purification while maintaining the native state

    • Reconstitution in appropriate membrane mimetics

    • Functional and structural characterization in the reconstituted system

Addressing these challenges requires interdisciplinary approaches combining biochemistry, biophysics, and structural biology techniques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.