Recombinant Parvibaculum lavamentivorans Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Physical and Biochemical Properties

As a recombinant protein expressed for research purposes, P. lavamentivorans uppP is typically produced with specific characteristics optimized for laboratory use. The commercially available recombinant forms of this protein demonstrate the following properties:

PropertySpecificationReference
Molecular WeightApproximately 29 kDaDerived from sequence
Purity>85% (SDS-PAGE)
Expression SystemE. coli
Storage BufferTris-based buffer, 50% glycerol
Recommended Storage-20°C to -80°C
Shelf Life (liquid)6 months at -20°C/-80°C
Shelf Life (lyophilized)12 months at -20°C/-80°C
Working Storage4°C for up to one week

Biological Function and Significance

Undecaprenyl-diphosphatase plays a crucial role in bacterial cell envelope biogenesis, particularly in the peptidoglycan synthesis pathway that is essential for bacterial survival and structural integrity.

Role in Bacterial Cell Wall Synthesis

Undecaprenyl phosphate (Und-P) serves as an essential lipid carrier that transports cell wall intermediates across the cytoplasmic membrane in bacteria . This lipid carrier, commonly referred to as bactoprenol, is a 55-carbon isoprene that functions as the foundation for peptidoglycan synthesis . The peptidoglycan sacculus is a stress-bearing structure that surrounds the cytoplasmic membrane and confers upon bacteria their characteristic shape .

The biosynthesis pathway begins with nucleotide-activated precursors in the cytoplasm that are assembled on Und-P to form the peptidoglycan precursor lipid II . This precursor is then translocated across the cytoplasmic membrane by a flippase and subsequently polymerized into glycan chains by peptidoglycan glycosyltransferases and cross-linked by peptidoglycan transpeptidases .

Enzymatic Mechanism and Pathway Integration

The cellular pool of Und-P is generated primarily through the dephosphorylation of undecaprenyl pyrophosphate (Und-PP) by integral membrane pyrophosphatases like uppP . This dephosphorylation occurs through two primary pathways:

  1. De novo synthesis pathway: Und-PP is synthesized in the cytoplasm via the non-mevalonate pathway and then dephosphorylated to Und-P .

  2. Recycling pathway: Und-PP released on the outer side of the cytoplasmic membrane during glycan polymerization is dephosphorylated to regenerate the Und-P carrier .

In Gram-negative bacteria like Escherichia coli, this process is carried out by multiple enzymes with BacA providing the majority of phosphatase activity, with smaller contributions from PAP2 enzymes including PgpB, YbjG, and LpxT . The P. lavamentivorans uppP enzyme belongs to this critical family of phosphatases.

Expression Systems and Purification

The recombinant P. lavamentivorans uppP protein is typically produced using E. coli expression systems . The production process typically involves:

  1. Cloning the uppP gene (Plav_1120) into an appropriate expression vector

  2. Transformation into E. coli expression strains

  3. Induction of protein expression

  4. Cell lysis and protein extraction

  5. Purification using affinity chromatography, often utilizing fusion tags

The tag type for commercial preparations is frequently determined during the production process and may vary between manufacturers . The final purified product typically achieves >85% purity as determined by SDS-PAGE analysis .

Formulation and Stability

Commercial preparations of recombinant P. lavamentivorans uppP are available in both liquid and lyophilized formats. The liquid formulation typically includes a Tris-based buffer with 50% glycerol optimized for protein stability . For reconstitution of lyophilized preparations, manufacturers recommend using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

Stability studies indicate that the shelf life varies depending on the formulation and storage conditions. Liquid preparations typically remain stable for approximately 6 months when stored at -20°C to -80°C, while lyophilized preparations maintain stability for up to 12 months under the same conditions . Manufacturers consistently recommend avoiding repeated freeze-thaw cycles, as these can significantly compromise protein integrity and enzymatic activity .

Genetic and Biochemical Studies

Undecaprenyl-diphosphatase enzymes have been the subject of significant research interest due to their essential role in bacterial cell wall synthesis. Recent genetic screens have identified system-wide connections between Und-P metabolism and various cellular processes, including cell division, DNA replication and repair, signal transduction, and glutathione metabolism . These findings highlight the integrated nature of cell envelope biogenesis with other fundamental cellular processes.

The undecaprenyl phosphate metabolism pathway has proven particularly important in understanding bacterial resistance mechanisms. For example, genetic studies have revealed that loss of certain undecaprenyl-diphosphatase enzymes can increase the susceptibility of bacteria to cell wall-active antimicrobial compounds . This connection makes enzymes like P. lavamentivorans uppP potential targets for the development of novel antimicrobial strategies.

Future Research Directions

The continued study of undecaprenyl-diphosphatase enzymes like P. lavamentivorans uppP holds promise for several areas of microbiological research:

  1. Antimicrobial development: Understanding the structure and function of these enzymes may facilitate the design of novel inhibitors that could serve as antibiotics or antibiotic adjuvants.

  2. Synthetic biology applications: As essential components of bacterial cell wall synthesis, these enzymes might be engineered for biotechnological applications involving cell wall modification or the production of cell wall-derived compounds.

  3. Evolution of cell envelope biogenesis: Comparative studies across bacterial species may reveal how these essential enzymes have evolved to support diverse bacterial lifestyles and environmental adaptations.

  4. Systems biology integration: Recent findings of connections between undecaprenyl phosphate metabolism and other cellular pathways suggest that a more holistic understanding of bacterial physiology requires consideration of these interconnections.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them when placing the order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Plav_1120; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Target Names
uppP
Target Protein Sequence
MNDPNFLHAIILGIVEGVSEFLPISSTGHLIIVGELLGFSSVPGKVFEVVIQLGAILAIC VLYSGRLTRVLRDAPRDAGARNFIGAIFVALIPAGLLGVLYHDFILEVLFTPYVVCAALI TGGIAIVVVERLHLEPRITSVEAFSMRTALKIGLFQCIALVPGVSRSGATILGALLVGVE RKTAAEFSFFLAIPVMLGASVVSLRDTWQLISMDDLHLIAAGFIAAFISALLVVKWLVSF VSSHGFTVFGWYRILFGSLLLIYFSLSS
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its function in bacteria?

Undecaprenyl-diphosphatase (uppP) is an integral membrane protein involved in bacterial cell wall synthesis. It catalyzes the critical dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as an essential carrier lipid in the bacterial cell wall biosynthetic pathway . The enzyme is also known by alternative names such as Bacitracin resistance protein and Undecaprenyl pyrophosphate phosphatase, indicating its role in antibiotic resistance mechanisms . The enzyme's function is fundamental to bacterial survival, as it maintains the pool of lipid carriers required for peptidoglycan synthesis, making it a potential target for antimicrobial development.

What is known about the protein structure of Parvibaculum lavamentivorans uppP?

Parvibaculum lavamentivorans uppP is a membrane protein containing specific consensus regions that form its active site. Sequence analysis reveals two critical motifs: an (E/Q)XXXe motif and a PGxSRSXXT motif, along with a conserved histidine residue . These regions are localized near the aqueous interface of the protein and face the periplasm, suggesting that the enzyme's biological function occurs on the outer side of the plasma membrane. Three-dimensional structural modeling and molecular dynamics simulations have provided insights into how these regions interact to form the catalytic site of the enzyme. The full amino acid sequence of the protein consists of 268 amino acids, which includes several transmembrane segments that anchor the protein within the bacterial membrane .

What are the optimal conditions for handling and storing Recombinant Parvibaculum lavamentivorans uppP?

For optimal handling of Recombinant Parvibaculum lavamentivorans uppP, researchers should adhere to specific storage protocols to maintain protein integrity. The protein should be stored at -20°C for regular storage, with -80°C recommended for extended preservation . Prior to opening, vials should be briefly centrifuged to bring contents to the bottom. For reconstitution, the protein should be dissolved in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL.

For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% before aliquoting and storing at -20°C or -80°C . The shelf life varies depending on storage conditions: liquid formulations typically remain stable for about 6 months, while lyophilized forms can maintain stability for up to 12 months when stored properly . Importantly, repeated freeze-thaw cycles should be avoided to prevent protein degradation, and working aliquots should be stored at 4°C for no more than one week to maintain enzymatic activity .

How can researchers effectively measure uppP enzymatic activity in vitro?

Measuring uppP enzymatic activity requires specialized methodology due to its integral membrane nature. Researchers can employ several approaches:

  • Radiolabeled substrate assay: Using 32P-labeled undecaprenyl pyrophosphate to measure the release of inorganic phosphate through scintillation counting.

  • Colorimetric phosphate detection: After the enzymatic reaction, released inorganic phosphate can be detected using malachite green or other phosphate-specific colorimetric reagents.

  • HPLC-based assay: Separation and quantification of the substrate (undecaprenyl pyrophosphate) and product (undecaprenyl phosphate) can be achieved using reverse-phase HPLC systems.

When conducting these assays, it is essential to include magnesium or calcium ions in the reaction buffer, as research has demonstrated an absolute requirement for these divalent cations for uppP enzymatic activity . Additionally, detergents or lipid reconstitution systems must be employed to maintain the protein in its active conformation, as uppP is an integral membrane protein that requires a hydrophobic environment to function properly.

What mutagenesis studies have revealed about uppP's catalytic mechanism?

Site-directed mutagenesis studies have provided significant insights into the catalytic mechanism of uppP enzymes. Research has demonstrated that specific amino acid residues are critical for enzyme function:

MutationEffect on Enzyme ActivityProposed Role in Catalysis
E17A~5-fold decrease in kcat, ~4-5-fold increase in KmInteraction with pyrophosphate moiety via Mg2+
E21A~5-fold decrease in kcatInteraction with pyrophosphate moiety via Mg2+
E17A/E21AComplete inactivationCritical for coordination with magnesium and substrate binding
H30ASevere impairment of activityProximity to pyrophosphate moiety, potential role in catalysis
S173AComplete inactivationPart of the PGxSRSXXT motif, likely involved in substrate orientation
R174AComplete inactivationEstablishes hydrogen bonds with OH group of pyrophosphate moiety
T178AComplete inactivationPart of the PGxSRSXXT motif, structural integrity of active site

These findings demonstrate that the catalytic site of uppP is composed of two consensus regions, with the glutamate residues in the (E/Q)XXXe motif interacting with the pyrophosphate group through a magnesium ion, and the PGxSRSXXT motif forming a structural P-loop where Arg-174 establishes hydrogen bonds with the substrate . The conserved His-30 is also found in close spatial proximity to the pyrophosphate moiety, suggesting a role in the catalytic mechanism.

How do computational approaches complement experimental studies of uppP?

Computational approaches have become invaluable tools for studying membrane proteins like uppP, where experimental structural determination faces significant challenges. Key computational methods include:

  • Three-dimensional structural modeling: The Rosetta membrane ab initio modeling program has been successfully used to predict the structure of uppP, providing insights into the spatial arrangement of the active site residues . This approach is particularly valuable for membrane proteins that resist crystallization.

  • Molecular dynamics (MD) simulations: MD simulations allow researchers to study the dynamic behavior of uppP within a lipid bilayer environment, revealing how the protein interacts with both its membrane environment and substrate. These simulations have helped validate structural models by demonstrating their stability in a simulated membrane environment .

  • Docking studies: Computational docking can predict how substrates and potential inhibitors bind to the active site, guiding both mechanistic studies and drug design efforts.

  • Sequence analysis and evolutionary studies: Comparative analysis of uppP sequences across bacterial species can identify evolutionarily conserved residues likely to be functionally important, directing experimental focus to these regions.

By integrating computational predictions with experimental validation through techniques such as site-directed mutagenesis, researchers can develop a more comprehensive understanding of uppP structure-function relationships than would be possible with either approach alone .

How does uppP contribute to bacterial antibiotic resistance?

Undecaprenyl-diphosphatase (uppP) plays a significant role in bacterial antibiotic resistance, particularly against antimicrobials that target cell wall synthesis. The enzyme is alternatively named "Bacitracin resistance protein," highlighting its importance in resistance mechanisms . This resistance function operates through multiple mechanisms:

  • Maintenance of undecaprenyl phosphate pool: By dephosphorylating undecaprenyl pyrophosphate to undecaprenyl phosphate, uppP ensures a sufficient supply of the essential lipid carrier needed for cell wall synthesis, even when some molecules are sequestered by antibiotics like bacitracin.

  • Competitive action: The enzyme's activity directly counteracts the mechanism of bacitracin, which binds to undecaprenyl pyrophosphate and prevents its dephosphorylation, thereby inhibiting cell wall synthesis.

  • Overexpression response: In some bacteria, exposure to cell wall-targeting antibiotics induces overexpression of uppP, enhancing the recycling of undecaprenyl carriers and contributing to resistance.

  • Structural modifications: Mutations in uppP that maintain catalytic activity while reducing antibiotic binding can confer resistance to specific antimicrobials.

Understanding these mechanisms is crucial for developing strategies to overcome antibiotic resistance, including the design of uppP inhibitors that could potentially restore bacterial susceptibility to existing antibiotics .

What approaches can be used to identify small-molecule inhibitors of uppP?

The identification of small-molecule inhibitors of uppP involves multiple complementary approaches:

  • Cell-based screening platforms: Researchers have developed screening platforms that enrich for inhibitors of related enzymes in the same pathway. For example, a screening platform for undecaprenyl diphosphate synthase (UppS) inhibitors has been successfully implemented . Similar strategies can be adapted for uppP inhibitor discovery, potentially by monitoring cell wall synthesis inhibition or bacitracin sensitivity.

  • Structure-based virtual screening: Using the computational models of uppP, virtual libraries of compounds can be screened for their potential to bind to the enzyme's active site. Compounds that show promise in silico can then be tested experimentally.

  • Fragment-based drug discovery: This approach involves screening small molecular fragments for binding to uppP, then iteratively growing or linking fragments to develop more potent inhibitors.

  • High-throughput enzymatic assays: Developing assays that can rapidly measure uppP activity in the presence of potential inhibitors allows for efficient screening of large compound libraries.

  • Phenotypic screens: Compounds can be screened for their ability to sensitize bacteria to bacitracin or other cell wall-targeting antibiotics, potentially identifying uppP inhibitors.

When evaluating potential inhibitors, it is important to assess not only their potency against the enzyme but also their selectivity and lack of off-target effects. For instance, many lipophilic compounds that inhibit membrane proteins can disrupt membrane potential non-specifically . The development of selective inhibitors like MAC-0547630, which exhibits nanomolar inhibition without affecting membrane potential, represents a significant advancement in this field .

What are the challenges in expressing and purifying functional recombinant uppP?

Expressing and purifying functional recombinant uppP presents several challenges due to its nature as an integral membrane protein:

  • Expression system selection: While E. coli is commonly used for expressing Parvibaculum lavamentivorans uppP , optimizing expression conditions is crucial. Factors such as induction temperature, inducer concentration, and expression duration must be carefully controlled to balance protein yield with proper folding.

  • Membrane extraction: Efficient extraction of uppP from bacterial membranes requires screening different detergents to identify those that effectively solubilize the protein while maintaining its native conformation and activity.

  • Purification strategy: Purification typically involves affinity chromatography using tags such as His-tags, followed by size exclusion chromatography. The choice of tag and its position (N- or C-terminal) can significantly impact protein yield and activity .

  • Maintaining protein stability: Throughout the purification process, uppP must be kept in an environment that mimics the membrane to prevent denaturation. This often requires the continuous presence of appropriate detergents or lipids.

  • Activity preservation: Even when pure protein is obtained, maintaining enzymatic activity is challenging. Researchers must verify that the purified protein retains its functional properties through activity assays.

  • Reconstitution for functional studies: For certain analyses, uppP may need to be reconstituted into liposomes or nanodiscs to provide a membrane-like environment that supports its native function.

Novel approaches, such as the use of fusion partners like bacteriorhodopsin, have shown promise in facilitating the expression and purification of functional membrane proteins for structural and functional studies .

How might structural studies of uppP inform antibiotic development?

Detailed structural studies of uppP could significantly advance antibiotic development through several avenues:

  • Structure-based drug design: High-resolution structures of uppP would enable rational design of inhibitors that precisely complement the enzyme's active site. Current computational models and molecular dynamics simulations provide valuable insights, but experimental structures would further refine our understanding of the binding pocket geometry and electrostatic properties .

  • Allosteric site identification: Structural studies might reveal allosteric sites distinct from the catalytic center that could be targeted by inhibitors, potentially offering greater selectivity and novel mechanisms of inhibition.

  • Species-specific variations: Comparative structural analysis of uppP from different bacterial species could highlight variations that might be exploited for developing narrow-spectrum antibiotics with reduced impact on beneficial microbiota.

  • Resistance mechanism elucidation: Structural studies of uppP variants associated with resistance could reveal how mutations alter inhibitor binding while preserving enzymatic function, informing strategies to overcome resistance.

  • Membrane interaction understanding: Determining how uppP is positioned within the membrane and how this positioning affects substrate access and product release could suggest novel approaches to inhibition that target these processes.

Current efforts using techniques such as cryo-electron microscopy, X-ray crystallography with lipidic cubic phase methods, and nuclear magnetic resonance spectroscopy of isotopically labeled protein are gradually overcoming the challenges associated with membrane protein structural determination .

What are promising methodological advances for studying membrane-bound enzymes like uppP?

Recent methodological advances have expanded researchers' capabilities for studying membrane-bound enzymes like uppP:

  • Nanodiscs and styrene-maleic acid lipid particles (SMALPs): These technologies allow extraction of membrane proteins with their native lipid environment intact, potentially preserving functional properties that might be lost in detergent-based systems.

  • Single-molecule techniques: Methods such as single-molecule FRET (Förster Resonance Energy Transfer) can provide insights into conformational changes during the catalytic cycle of uppP, which may not be apparent in ensemble measurements.

  • Native mass spectrometry: Advances in this field now permit analysis of intact membrane protein complexes, providing information about stoichiometry, lipid interactions, and binding of small molecules.

  • Cryo-electron tomography: This technique allows visualization of proteins in their cellular context, potentially revealing how uppP is organized within the bacterial membrane and how it interacts with other components of the cell wall synthesis machinery.

  • Time-resolved spectroscopy: These methods can track the kinetics of conformational changes and catalytic steps at microsecond to millisecond timescales, providing detailed mechanistic insights.

  • Advanced computational methods: Developments in molecular dynamics simulations, including enhanced sampling techniques and polarizable force fields, enable more accurate modeling of membrane protein behavior in lipid bilayers.

The integration of these methodological advances promises to provide unprecedented insights into the structure, dynamics, and function of uppP and other membrane-bound enzymes involved in bacterial cell wall synthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.