Recombinant Pasteurella multocida 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
ubiA; PM1751; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
ubiA
Target Protein Sequence
MPISKQKWIAYAQLMRFDKPIGTLLLLWPTLWALFLSVKGMPDLSILSIFVLGVIFMRAA GCVINDYADRHIDGAVKRTSKRPLATGAATPEEAKWLFVLLVFCSFILVLFLNTYAIVLS FIAVFLAFIYPFMKRYTHLPQLFLGMAFGWSIPMAYGASIEALPLECWLLFFANLAWTVA YDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIISLLQIVTLFFLGLIGYLSQLHTSYFVV LFLATLLFVYQCKLIKDRERESCFKAFLNNNYFGAMVFVAFLFGIFFDKL
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis, which involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: pmu:PM1751

STRING: 272843.PM1751

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is 4-hydroxybenzoate octaprenyltransferase (ubiA) and what is its role in bacterial metabolism?

4-hydroxybenzoate octaprenyltransferase (UbiA) is a critical enzyme in the ubiquinone biosynthesis pathway of bacteria. UbiA catalyzes the formation of 4-hydroxy-3-octaprenylbenzoate (4-H-3-OPB) from 4-hydroxybenzoate (4-HB) and octaprenyl pyrophosphate. This represents an essential early step in the biosynthesis of ubiquinone-8 (UQ 8), which continues through a series of decarboxylation, hydroxylation, and methylation reactions . The ubiquinone pathway is vital for aerobic respiration in many Gram-negative bacteria, making UbiA an essential enzyme for bacterial energy metabolism under aerobic conditions .

How does the ubiquinone biosynthesis pathway function in Pasteurella multocida?

While the search results don't specifically describe the ubiquinone pathway in P. multocida, the pathway is conserved across Gram-negative bacteria. In bacterial systems, 4-hydroxybenzoate (4-HB) is synthesized from chorismate through the action of chorismate pyruvate-lyase (UbiC), which forms 4-HB and pyruvate from chorismate . UbiA then catalyzes the prenylation of 4-HB using octaprenyl pyrophosphate as the prenyl donor. This initiates a series of enzymatic modifications ultimately leading to ubiquinone-8 synthesis, which is critical for the electron transport chain in aerobic respiration.

What methods are typically used to clone and express recombinant proteins from Pasteurella multocida?

Based on methodologies used for other P. multocida proteins, recombinant protein expression typically follows this protocol:

  • Genomic DNA extraction from P. multocida strains using bacterial genome extraction kits

  • PCR amplification of the target gene using specific primers designed based on published sequences

  • Cloning into expression vectors (such as pET series vectors) using homologous recombination or restriction enzyme-based cloning

  • Transformation into expression host cells (typically E. coli BL21(DE3))

  • Induction of protein expression using IPTG

  • Purification of His-tagged recombinant proteins using affinity chromatography

For instance, in the expression of other P. multocida proteins, researchers have successfully used the pET43.1a vector with PCR amplification conditions of 95°C for 5 min, followed by 30 cycles of 94°C for 30s, 60°C for 30s, and 72°C for 1 min, with a final extension at 72°C for 5 min .

What are the optimal conditions for expressing recombinant P. multocida ubiA in E. coli expression systems?

While the search results don't provide specific conditions for ubiA, extrapolating from successful expression of other P. multocida membrane proteins, the following conditions would likely be optimal:

  • Expression vector: pET system vectors (such as pET43.1a) with T7 promoter

  • Host strain: E. coli BL21(DE3) or its derivatives

  • Induction conditions: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Post-induction growth: 16-18 hours at lower temperatures (16-25°C) to enhance proper folding of membrane proteins

  • Lysis buffer: Inclusion of mild detergents (0.5-1% Triton X-100 or n-dodecyl β-D-maltoside) to solubilize the membrane-associated protein

These conditions would need to be optimized for ubiA specifically, as it is a membrane-associated enzyme.

What purification strategies are most effective for obtaining high-purity recombinant ubiA protein?

For membrane-associated proteins like ubiA, a multi-step purification process would likely include:

  • Affinity chromatography using His-tag affinity (Ni-NTA or TALON resin)

  • Buffer optimization containing appropriate detergents to maintain protein solubility

  • Size exclusion chromatography to remove aggregates and impurities

  • Ion exchange chromatography as a polishing step

Protein purity should be assessed using SDS-PAGE, with expected molecular weight verification. For example, other recombinant P. multocida proteins have been successfully purified to high homogeneity and confirmed by both SDS-PAGE and Western blot analysis using anti-His antibodies .

How can researchers verify the structural integrity and functionality of purified recombinant ubiA?

Verification methods would include:

  • Enzymatic activity assay: Measuring the conversion of 4-hydroxybenzoate to 4-hydroxy-3-octaprenylbenzoate using substrate competition assays or direct product detection via HPLC or LC-MS

  • Circular dichroism (CD) spectroscopy: To assess secondary structural elements

  • Thermal shift assays: To evaluate protein stability

  • Binding studies: Using isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to assess substrate binding

Functional verification could be performed using complement assays in ubiA-deficient bacterial strains to determine if the recombinant protein can restore ubiquinone synthesis.

What methodologies are used to study the enzymatic activity of UbiA in vitro?

In vitro enzymatic activity of UbiA can be studied using:

  • Radioisotope-based assays: Using radiolabeled substrates (14C or 3H-labeled 4-hydroxybenzoate) to track the formation of prenylated products

  • HPLC-based assays: To separate and quantify the substrate (4-HB) and product (4-hydroxy-3-octaprenylbenzoate)

  • Coupled enzyme assays: Where the activity of UbiA is linked to a detectable signal

  • Competition assays: Similar to those demonstrated with DHB, which competes with 4-HB for UbiA binding

Research has shown that UbiA activity can be monitored through competition assays using substrate analogs. For example, the compound 3,6-dihydroxy-1,2-benzisoxazole (DHB) binds to UbiA and prevents the formation of 4-hydroxy-3-octaprenylbenzoate, demonstrating competitive inhibition with a quantifiable FIC value of 8 .

How does the UbiA enzyme from P. multocida compare structurally and functionally with UbiA from other bacterial species?

While the search results don't provide specific structural comparisons of P. multocida UbiA with other species, we can infer that:

  • UbiA is likely highly conserved across Gram-negative bacteria due to its essential role in ubiquinone biosynthesis

  • The enzyme likely shares the same catalytic mechanism across species, involving prenyl transfer from octaprenyl pyrophosphate to 4-hydroxybenzoate

  • Structural variations might exist in substrate binding pockets, potentially affecting inhibitor specificity

For instance, studies with DHB showed that it selectively inhibits UbiA from various Gram-negative bacteria, including E. coli, Enterobacter cloacae, Klebsiella pneumoniae, and Acinetobacter baumannii, suggesting structural conservation of the active site across these species .

What factors affect the catalytic efficiency of recombinant UbiA enzyme?

Several factors can influence UbiA catalytic efficiency:

  • Substrate availability: The relative concentration of 4-HB affects enzyme activity, as demonstrated by competition experiments where increased 4-HB levels reduced DHB inhibition

  • Expression conditions: Metabolic state of the cell influences ubiA expression; glucose has been shown to repress ubiA transcription

  • Membrane environment: As a membrane-associated enzyme, lipid composition may affect activity

  • Regulatory factors: Cellular regulation mechanisms may control UbiA activity in response to metabolic needs

For example, experimental evidence has shown that E. coli cells with knockout of the AaeAB efflux pump (which normally exports 4-HB) required 4-6 fold more DHB (16-64 μg/mL) for inhibition compared to wild-type cells, demonstrating how increased intracellular 4-HB competes with inhibitors for UbiA binding sites .

How can recombinant UbiA be used to screen for novel antimicrobial compounds?

Recombinant UbiA can serve as a valuable tool for antimicrobial discovery:

  • High-throughput screening: Purified recombinant UbiA can be used in enzyme-based screens to identify compounds that inhibit its activity

  • Structure-based drug design: Knowing the structure of UbiA enables rational design of inhibitors

  • Competitive binding assays: Similar to studies with DHB, compounds can be screened for their ability to compete with 4-HB for UbiA binding

  • Whole-cell assays: Using bacterial strains expressing recombinant UbiA to identify compounds with antimicrobial activity

The approach is validated by research showing that compounds like DHB target UbiA and exhibit antimicrobial activity against various Gram-negative bacteria while remaining inactive against anaerobic gut bacteria and non-toxic to human cells .

What is the mechanism of UbiA inhibition and how can it be leveraged for antimicrobial development?

The UbiA inhibition mechanism, exemplified by DHB, involves:

  • Competitive inhibition: DHB competes with 4-HB for binding to UbiA's active site

  • Prodrug mechanism: DHB itself becomes prenylated by UbiA, forming an unusable chimeric product that contributes to toxicity

  • Selectivity: Inhibition depends on specific structural features of bacterial UbiA

This dual mode of action (both competitive inhibitor and prodrug) represents an unusual and potentially advantageous mechanism for antimicrobial compounds . This knowledge can be leveraged to develop more potent inhibitors that:

  • Bind more strongly to the UbiA active site

  • Become modified by the enzyme into more toxic derivatives

  • Maintain selectivity for bacterial over mammalian systems

What structural features of UbiA inhibitors correlate with antimicrobial efficacy?

Based on studies with DHB, important structural features include:

  • Substrate mimicry: Effective inhibitors structurally resemble 4-HB to compete for the active site

  • Prenylation capacity: Compounds that can be prenylated by UbiA may have enhanced activity

  • Selectivity determinants: Features that interact with specific UbiA folds contribute to selectivity for Gram-negative bacteria

The DHB example demonstrates these principles, as it:

  • Resembles 4-HB structurally

  • Gets prenylated by UbiA into a toxic product

  • Shows selectivity for Gram-negative bacteria while being inactive against anaerobic gut bacteria and human cells

How does ubiquinone biosynthesis inhibition compare with other antimicrobial targets in P. multocida?

While the search results don't directly compare UbiA inhibition to other targets in P. multocida specifically, we can infer key differences:

  • Target essentiality: UbiA inhibition affects aerobic respiration, making it effective primarily under aerobic conditions

  • Resistance development: Mutations in the ubiquinone pathway can confer resistance to UbiA inhibitors

  • Spectrum of activity: UbiA inhibitors may have a narrower spectrum compared to traditional antibiotics

This can be contrasted with other P. multocida targets used in vaccine development, such as outer membrane proteins (OmpH) and lipoproteins (PlpE, VacJ), which have shown varying degrees of immunogenicity and protection in animal models .

What are the metabolic consequences of UbiA inhibition in bacterial cells?

Inhibition of UbiA disrupts ubiquinone biosynthesis, leading to:

  • Impaired electron transport: Reduced ATP production through oxidative phosphorylation

  • Accumulated reactive oxygen species: Due to disruption of the electron transport chain

  • Metabolic shifts: Cells may attempt to compensate through alternative respiratory pathways

  • Growth inhibition: Under aerobic conditions where ubiquinone is essential

The selective activity of UbiA inhibitors against aerobic bacteria but not anaerobic bacteria supports this mechanism, as anaerobic organisms do not rely primarily on ubiquinone-dependent respiration .

How can researchers address challenges in expressing and studying membrane-associated enzymes like UbiA?

Key strategies include:

  • Optimized expression systems:

    • Use of specialized E. coli strains (C41, C43) designed for membrane protein expression

    • Codon optimization for enhanced expression

    • Controlled expression rates using tunable promoters

  • Solubilization approaches:

    • Screening multiple detergents for optimal solubilization

    • Nanodiscs or liposome reconstitution for functional studies

    • Fusion partners to enhance solubility

  • Structural studies:

    • Crystallization in lipidic cubic phases

    • Cryo-EM for structure determination without crystallization

    • NMR studies of dynamics and ligand binding

These approaches could overcome the inherent challenges of working with membrane proteins like UbiA.

How does recombinant P. multocida UbiA compare with commercially available UbiA from other bacterial sources?

Based on available information about other recombinant bacterial proteins, a comparative analysis would consider:

FeatureP. multocida UbiAOther Bacterial UbiA (e.g., E. coli)S. typhi UbiA
Molecular Weight~38-40 kDa (estimated)~32-35 kDaPartial protein available
Expression SystemE. coli BL21(DE3) with pET vectorsSimilar E. coli systemsSimilar expression systems
Purification TagsHis-tag fusion proteinsVarious affinity tagsHis-tag likely used
SolubilityMembrane-associated, requires detergentsSimilar requirementsSimilar requirements
Specific ActivityData not availableVaries by sourceData not available
Substrate SpecificityLikely specific for 4-HBWell-characterizedData not available

Note: Exact comparative data is limited in the search results, and this table represents a framework that would need to be populated with experimental data.

What methodological improvements have enhanced recombinant expression of membrane proteins from P. multocida?

While specific improvements for UbiA are not detailed, advancements for P. multocida membrane protein expression include:

  • Vector optimization: The use of vectors like pET43.1a that provide fusion partners to enhance solubility and expression

  • Expression conditions: Careful optimization of induction parameters (temperature, IPTG concentration)

  • Purification approaches: Multi-step purification strategies including affinity chromatography and size exclusion

  • Validation methods: Western blot confirmation of protein identity and purity

For instance, successful expression of P. multocida outer membrane proteins has been achieved using PCR amplification of target genes, cloning into pET expression vectors, and expression in E. coli BL21(DE3), followed by affinity purification and verification by both SDS-PAGE and Western blot analysis .

What are the key differences in experimental approaches when studying UbiA as an antimicrobial target versus its native enzymatic function?

Research FocusExperimental ApproachesKey MeasurementsChallenges
Native Enzymatic Function- Enzyme kinetics
- Substrate specificity
- Structure-function studies
- Metabolic integration
- Km, Vmax values
- Product formation rates
- Structural determination
- Metabolic flux analysis
- Maintaining enzyme stability
- Recreating membrane environment
- Measuring lipophilic products
Antimicrobial Target- Inhibition assays
- Resistance development
- Cytotoxicity testing
- In vivo efficacy
- IC50/MIC values
- Resistance frequency
- Therapeutic index
- In vivo protection
- Target validation
- Resistance mechanisms
- Delivery to target site
- Specificity for bacterial UbiA

When studying UbiA as an antimicrobial target, researchers must consider additional factors like bacterial cell penetration, selectivity against mammalian homologs, and potential resistance mechanisms, as demonstrated by studies with DHB that showed selective activity against Gram-negative bacteria while remaining inactive against anaerobic gut bacteria and non-toxic to human cells .

What emerging technologies could enhance structural and functional studies of UbiA?

Several cutting-edge technologies could advance UbiA research:

  • Cryo-EM advances: Allowing structure determination of membrane proteins without crystallization

  • Nanobody technology: Developing stabilizing nanobodies for structural studies

  • Microfluidic enzyme assays: Enabling high-throughput screening with minimal enzyme consumption

  • AI-driven structural predictions: Using systems like AlphaFold2 to predict interactions with substrates or inhibitors

  • CRISPR-based screening: Identifying genetic interactions and resistance mechanisms

These approaches could overcome current limitations in studying membrane-associated enzymes like UbiA.

How might understanding UbiA function contribute to developing novel antimicrobial strategies against P. multocida infections?

Research into P. multocida UbiA could lead to:

  • Targeted inhibitors: Development of specific UbiA inhibitors with selective activity against P. multocida

  • Combination approaches: Using UbiA inhibitors alongside vaccines containing recombinant outer membrane proteins like PlpE or OmpH, which have shown protective efficacy in animal models

  • Resistance prevention: Understanding resistance mechanisms to UbiA inhibition to develop strategies to overcome or prevent resistance

  • Cross-species targeting: Developing broad-spectrum agents that target conserved features of UbiA across multiple pathogens

For example, research has shown that combining multiple recombinant proteins (VacJ, PlpE, OmpH) provides 100% protection against P. multocida challenge in ducks . Similar combinatorial approaches incorporating UbiA inhibition could enhance antimicrobial strategies.

What potential applications exist for recombinant UbiA beyond antimicrobial research?

Recombinant UbiA could have applications in:

  • Enzymatic synthesis: Production of prenylated compounds for pharmaceutical or industrial applications

  • Metabolic engineering: Enhancing ubiquinone production in industrial strains

  • Biosensor development: Creating detection systems for specific compounds that interact with UbiA

  • Evolutionary studies: Investigating the conservation and divergence of ubiquinone biosynthesis across bacterial species

  • Synthetic biology: Incorporating UbiA into designer pathways for novel compound synthesis

These diverse applications highlight the value of understanding and manipulating UbiA beyond its role as an antimicrobial target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.