Recombinant Pasteurella multocida ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant atpB

The recombinant atpB protein corresponds to the full-length sequence (1–264 amino acids) of P. multocida ATP synthase subunit a, encoded by the atpB gene (UniProt ID: Q9CKW6). It includes an N-terminal His tag for purification and detection purposes .

PropertyDetail
Catalog NumberRFL15171PF
Host OrganismEscherichia coli (prokaryotic expression system)
Molecular WeightPredicted ~30 kDa (unprocessed); observed ~84–97 kDa when fused
Structural RoleIntegral membrane component of F₀ sector, enabling proton translocation
Purification MethodAffinity chromatography via His tag

The discrepancy in observed molecular weight (e.g., 84.4 kDa in other P. multocida recombinant proteins ) suggests fusion partners or post-translational modifications in specific constructs.

Genetic Context and Functional Significance

The atpB gene is part of the atp operon, which in P. multocida includes eight subunits critical for ATP synthase assembly . This operon’s structure—atpH-atpA-atpG in neighboring regions —highlights evolutionary conservation across bacterial species. ATP synthase subunit a (atpB) directly participates in proton channeling across the membrane, coupling proton motive force to ATP synthesis .

Applications in Antimicrobial Research

While no direct studies on recombinant atpB’s immunogenicity or therapeutic potential were identified, ATP synthase is a validated target for antimicrobial agents due to its essential role in energy metabolism. For example:

  • Drug Discovery: Bacterial ATP synthase inhibitors (e.g., bedaquiline analogs) could leverage recombinant atpB for target validation .

  • Vaccine Development: Though current P. multocida subunit vaccines focus on outer membrane proteins (e.g., PlpE, OmpH) , atpB’s conservation makes it a candidate for cross-protective epitope exploration.

##Technical Considerations for Experimental Use

  • Expression Challenges: Membrane proteins like atpB often require detergent solubilization for stability .

  • Antigenic Potential: His tags may interfere with antibody recognition in immunological assays; tag-free versions might be preferable for epitope mapping.

  • Functional Assays: Proton translocation assays using proteoliposomes could validate recombinant atpB’s activity .

Comparative Analysis with Other P. multocida Antigens

While recombinant atpB remains understudied compared to immunodominant targets like PlpE or OmpH, its inclusion in multi-antigen formulations could enhance protection breadth. For instance:

AntigenProtection EfficacyStudy Model
PlpE83.33% survival in ducks Duck cholera challenge
OmpH83.33% survival in ducks Duck cholera challenge
PmSLP-3100% survival in cattle Bovine challenge

Future Directions

  • Structural Studies: Cryo-EM of recombinant atpB could elucidate proton channel architecture.

  • Adjuvant Synergy: Pairing atpB with TLR agonists (e.g., Poly(I:C)) might enhance Th1 responses, as seen with PmSLP-3 .

  • Cross-Species Protection: Evaluating atpB’s conservation across Pasteurella spp. may support pan-pathogen vaccine design.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; PM1488; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
atpB
Target Protein Sequence
MAAELTTAGYIGHHLAFLKTGDSFWHVHLDTLLFSIISGAIFLFVFSKVAKKATPGVPSK MQCFVEIMVDWIDGIVKENFHGPRHAVGPLALTIFCWVFIMNAIDLIPVDFLPQLAHLFG IEYLRAVPTADISGTLGLSIGVFFLIIFYTIKSKGMSGFVKEYTLHPFNHPLLIPVNLAL ESVTLLAKPVSLAFRLFGNMYAGELIFILIAVMYMANNFALNSMGIFMHLAWAIFHILVI TLQAFIFMMLTVVYLSMGYNKAEH
Uniprot No.

Target Background

Function
Key component of the proton channel, playing a direct role in the translocation of protons across the membrane.
Database Links

KEGG: pmu:PM1488

STRING: 272843.PM1488

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (atpB) in Pasteurella multocida and what is its function?

ATP synthase subunit a (atpB) is a critical membrane protein component of the F0 sector of ATP synthase in Pasteurella multocida. This 264-amino acid protein (UniProt ID: Q9CKW6) plays an essential role in the chemiosmotic mechanism of ATP production .

The atpB subunit forms part of the proton channel within the membrane-embedded F0 portion of ATP synthase. It works by:

  • Facilitating proton movement across the bacterial membrane

  • Converting the energy from proton gradient into mechanical energy

  • Enabling the rotation of the central stalk, which drives conformational changes in the F1 sector catalytic sites

  • Contributing to ATP synthesis by coupling proton translocation to ATP formation

The protein contains multiple transmembrane domains with hydrophobic regions that anchor it within the bacterial membrane, creating the pathway for proton translocation. Structurally, it contains several highly conserved amino acid residues that are crucial for proton translocation and interaction with other ATP synthase subunits .

How is recombinant Pasteurella multocida atpB protein produced for research applications?

Recombinant Pasteurella multocida ATP synthase subunit a (atpB) protein is typically produced using heterologous expression systems, with E. coli being the most common host . The production process involves:

  • Gene cloning: The atpB gene (PM1488) is amplified from P. multocida genomic DNA and cloned into an expression vector.

  • Fusion tag addition: Commonly fused with an N-terminal His-tag to facilitate purification .

  • Expression optimization: Culture conditions are adjusted (temperature, induction time, media composition) to maximize protein yield.

  • Protein extraction: Membrane proteins like atpB require specialized extraction techniques using detergents to solubilize from the membrane.

  • Purification: Affinity chromatography using the His-tag, followed by additional purification steps such as ion exchange or size exclusion chromatography.

  • Quality assessment: SDS-PAGE analysis typically confirms >90% purity .

  • Storage: Lyophilization with stabilizing agents (such as 6% trehalose) and storage at -20°C/-80°C to maintain protein stability .

For optimal results, researchers should avoid repeated freeze-thaw cycles and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage .

What experimental approaches are available for studying atpB function in Pasteurella multocida?

Several experimental approaches can be employed to study atpB function in P. multocida:

ApproachMethodologyApplicationsLimitations
Recombinant protein studiesExpression and purification of atpB for in vitro analysisStructure-function relationshipsMay not reflect native membrane environment
ATP synthesis assaysMeasurement of ATP production using luciferase-based detection systemsQuantitative assessment of functionalityRequires careful control of experimental conditions
Site-directed mutagenesisTargeted modification of specific amino acid residuesIdentification of critical functional domainsRequires follow-up functional validation
Membrane reconstitutionIncorporation of purified atpB into artificial liposomesAnalysis of proton translocationComplex technical requirements
Proton gradient measurementspH-sensitive fluorescent probesAssessment of proton-translocating activityIndirect measurement of activity
Knockout/complementation studiesGene deletion and subsequent complementationIn vivo relevance of atpBPotential lethality due to essential function

The chemiosmotic experimental approach described in search result can be adapted for P. multocida atpB functional studies. This involves creating conditions with controlled proton gradients to measure ATP production, providing direct evidence of atpB's role in energy conversion .

How does atpB contribute to Pasteurella multocida pathogenesis and virulence?

While direct evidence linking atpB to P. multocida virulence is still emerging, several mechanisms have been proposed:

  • Energy provision for virulence factor expression: ATP synthase provides the energy required for the production and secretion of virulence factors such as the Pasteurella multocida toxin (PMT) .

  • Adaptation to host environments: ATP synthase allows bacterial adaptation to varying pH and energy conditions encountered during host infection.

  • Potential immunomodulatory effects: Similar to findings with other bacterial ATP synthase components, atpB may interact with host immune responses. PMT has been shown to manipulate T cell differentiation and signaling cascades, suggesting complex host-pathogen interactions that may indirectly involve energy metabolism proteins .

  • Biofilm formation support: ATP production is critical for biofilm development, which enhances P. multocida survival in hostile environments.

Recent research on other P. multocida proteins such as VacJ, PlpE, and OmpH has demonstrated their immunogenicity and protective efficacy , suggesting that membrane proteins, including potentially atpB, could be important in host-pathogen interactions.

What technical challenges exist when working with recombinant Pasteurella multocida atpB?

Researchers working with recombinant P. multocida atpB face several technical challenges:

  • Membrane protein solubility: As an integral membrane protein, atpB is highly hydrophobic, making it difficult to maintain in solution without appropriate detergents.

  • Conformational integrity: Ensuring the recombinant protein maintains its native conformation outside the membrane environment is challenging. This can be addressed by:

    • Using mild detergents like DDM or CHAPS

    • Employing membrane-mimetic systems (nanodiscs, amphipols)

    • Optimizing buffer conditions to stabilize the protein structure

  • Expression toxicity: Overexpression of membrane proteins often causes toxicity in host cells, requiring:

    • Use of tightly regulated expression systems

    • Lower induction temperatures (16-25°C)

    • Specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Functional reconstitution: Demonstrating that purified atpB retains its native function requires complex reconstitution experiments similar to those described for chloroplast ATP synthase , including:

    • Creation of artificial membrane vesicles

    • Integration of purified atpB into these systems

    • Establishment of proton gradients to measure ATP synthesis

  • Protein yield: Typical yields of membrane proteins are significantly lower than soluble proteins, often requiring large-scale cultures and optimized extraction methods.

What are the most effective methods for evaluating interactions between atpB and other ATP synthase subunits?

Evaluating protein-protein interactions involving the hydrophobic atpB protein requires specialized approaches:

MethodApplication to atpBAdvantagesLimitations
Crosslinking coupled with mass spectrometryIdentifies interaction interfaces between atpB and other subunitsCan capture transient interactionsMay introduce artifacts
FRET (Förster Resonance Energy Transfer)Measures proximity between fluorescently labeled subunitsWorks in living cellsRequires genetic modification
Co-immunoprecipitation with specific antibodiesPulls down protein complexes containing atpBPreserves native interactionsChallenging with membrane proteins
Bacterial two-hybrid systemsDetects interactions in a cellular contextSuitable for membrane proteinsMay yield false positives
Surface plasmon resonanceMeasures binding kinetics between purified componentsProvides quantitative dataRequires purified stable proteins
Cryo-electron microscopyVisualizes entire ATP synthase complexReveals structural arrangementTechnically demanding

The development of specific antibodies against P. multocida atpB, similar to the recombinant antibodies developed for other ATPB proteins , could significantly facilitate these interaction studies.

How does atpB function within the broader context of Pasteurella multocida bioenergetics?

In the context of P. multocida bioenergetics, atpB functions as part of a sophisticated energy transduction system:

  • Respiratory chain integration: The proton gradient generated by the respiratory chain drives ATP synthesis through the F0 sector containing atpB.

  • Chemiosmotic coupling: ATP synthase, including atpB, converts the energy stored in proton gradients into the chemical energy of ATP through the chemiosmotic mechanism .

  • Bidirectional functionality: Under certain conditions, ATP synthase can work in reverse, hydrolyzing ATP to pump protons and maintain membrane potential.

  • Metabolic flexibility: The ATP synthase system contributes to P. multocida's ability to adapt to different host environments with varying oxygen and nutrient availability.

  • Energy support for virulence: The ATP produced supports various virulence mechanisms, including the production of toxins like PMT that manipulate host signaling cascades .

Experiments similar to those conducted with chloroplast thylakoids could be adapted to study P. multocida ATP synthase function. These involve creating proton gradients across membranes containing ATP synthase to drive ATP synthesis, confirming the chemiosmotic mechanism .

What is the potential of atpB as a target for vaccine development against Pasteurella multocida infections?

The potential of P. multocida atpB as a vaccine target can be analyzed through several perspectives:

  • Conservation and essentiality: As a highly conserved protein essential for bacterial survival, atpB presents a potentially stable target that would be difficult for the bacterium to alter without fitness costs.

  • Surface exposure: While predominantly membrane-embedded, certain portions of atpB may be surface-exposed and accessible to antibodies, similar to other membrane proteins being investigated as vaccine candidates .

  • Immunogenicity considerations: Research into other P. multocida membrane proteins has shown promising immunogenicity results. Similar approaches could be applied to determine if atpB or specific epitopes could elicit protective immune responses .

  • Delivery systems: Recombinant atpB or its epitopes could be incorporated into modern vaccine platforms:

    • Subunit vaccines with appropriate adjuvants

    • mRNA-based approaches

    • Viral vector systems

    • Peptide vaccines targeting specific epitopes

  • Cross-protection potential: The conservation of atpB across P. multocida strains might provide cross-protection against multiple serotypes, addressing the challenge of strain diversity.

Duck cholera and other P. multocida infections continue to impact animal industries significantly , highlighting the need for effective vaccines based on well-characterized bacterial components.

How can systems biology approaches enhance our understanding of atpB's role in Pasteurella multocida?

Systems biology offers powerful frameworks to understand atpB within the broader context of P. multocida biology:

This multi-dimensional understanding could identify novel therapeutic approaches targeting bacterial energy metabolism during specific phases of infection.

What methodological considerations are important when detecting and quantifying atpB expression levels in Pasteurella multocida?

Accurate detection and quantification of atpB in P. multocida requires careful methodological considerations:

MethodApplicationTechnical Considerations
qRT-PCRmRNA expression analysisRequires careful primer design and robust reference genes
Western blottingProtein level detectionBenefits from specific antibodies such as recombinant monoclonal antibodies
Mass spectrometryAbsolute quantificationRequires careful sample preparation to extract membrane proteins
Flow cytometrySingle-cell analysisNecessitates permeabilization protocols for intracellular proteins
ImmunohistochemistryTissue localizationDepends on antibody specificity and tissue processing methods
Reporter gene fusionsPromoter activity analysisRequires genetic manipulation of P. multocida

For membrane proteins like atpB, special consideration must be given to:

  • Extraction efficiency with different detergent systems

  • Prevention of protein aggregation during sample processing

  • Potential post-translational modifications that might affect detection

  • Standardization against appropriate controls to ensure quantitative accuracy

Using recombinant antibodies with demonstrated specificity, similar to the ATPB antibody described in search result , could significantly improve detection sensitivity and specificity.

How does Pasteurella multocida atpB compare structurally and functionally to homologs in other bacterial pathogens?

Comparative analysis reveals important insights about P. multocida atpB in relation to other bacterial pathogens:

Understanding these similarities and differences provides context for developing species-specific interventions while leveraging broadly applicable research findings.

What emerging technologies are advancing research on bacterial ATP synthase components like atpB?

Several cutting-edge technologies are transforming our ability to study membrane proteins like P. multocida atpB:

  • Cryo-electron microscopy (Cryo-EM): Enables visualization of membrane proteins in near-native states without crystallization, potentially revealing dynamic conformational changes during ATP synthesis.

  • AlphaFold and other AI structure prediction tools: Provide increasingly accurate structural models of proteins like atpB, facilitating structure-based drug design.

  • Single-molecule biophysics: Techniques such as optical tweezers and magnetic tweezers allow direct observation of ATP synthase rotation and force generation at the single-molecule level.

  • Nanodiscs and other membrane mimetics: Provide improved platforms for functional reconstitution of membrane proteins, maintaining their native structure and function.

  • CRISPR-based screening: Enables precise genetic manipulation to study atpB function in vivo, including conditional knockdowns of this essential gene.

  • Time-resolved structural methods: X-ray free-electron lasers (XFELs) can capture transient structural states during the catalytic cycle of ATP synthase.

  • Advanced spectroscopic methods: Techniques like solid-state NMR provide atomic-level insights into membrane protein structure and dynamics.

Market research indicates significant growth in the tools supporting such advanced protein studies, with the broader ATPB antibody market valued at approximately USD 320 million in 2022 and growing at a CAGR of 6.5% , reflecting the increasing research interest in ATP synthase components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.