Recombinant Pasteurella multocida Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant dsbB

Recombinant dsbB is a periplasmic oxidoreductase involved in disulfide bond formation, essential for the structural stability of secreted and membrane-associated proteins in P. multocida. Key features include:

PropertyDetails
Amino Acid Range1–178 (full-length catalytic domain)
Gene NamedsbB (locus PM0046 in strain Pm70)
UniProt IDQ9L6B3
Expression SystemsE. coli, Yeast, Baculovirus, Mammalian Cells
Molecular Weight~20–25 kDa (estimated from sequence)
Key DomainsTransmembrane helices, redox-active cysteines

The protein is produced with a His-tag for purification and stored in Tris-based buffers with 50% glycerol at -20°C .

Role in Bacterial Virulence and Pathogenesis

DsbB facilitates the reoxidation of DsbA, a thiol-disulfide oxidoreductase, enabling proper folding of virulence factors. Key findings:

  • Virulence Attenuation: dsbB mutants in related pathogens (e.g., Actinobacillus pleuropneumoniae) show 10-fold reduced virulence in vivo, highlighting its importance in infection .

  • Iron Regulation: The dsbB operon in P. multocida is iron-regulated and activated within 2 hours of host infection, suggesting a role in early pathogenesis .

  • Conservation: The hgbA-dsbB operon is conserved across P. multocida serotypes, making it a broad-spectrum therapeutic target .

Applications in Vaccine Development

Recombinant dsbB is investigated as a subunit vaccine component due to its surface exposure and role in pathogenicity:

Table 1: Vaccine Efficacy of Recombinant P. multocida Proteins

Vaccine FormulationProtection Rate (Duck Model)Bacterial Load Reduction (Organs)Source
rPlpE + adjuvant83.33%99.9% (liver, spleen)
rOmpH + adjuvant83.33%99.8% (lung, kidney)
rVacJ + rPlpE + rOmpH100%99.99% (all tissues)
Killed whole-cell vaccine50%90% (average)

While dsbB itself has not been directly tested in these trials, its functional partners (e.g., PlpE, OmpH) demonstrate high immunogenicity, suggesting combinatorial use with dsbB could enhance protection .

Production and Purification Protocols

Industrial-scale production employs E. coli systems for cost-effectiveness:

ParameterSpecification
VectorpET-43.1a (for His-tagged fusion)
Purity>90% (SDS-PAGE verified)
Yield50 µg/mL (typical for research-grade batches)
Storage-80°C in Tris/PBS + 6% trehalose; avoid freeze-thaw cycles

Therapeutic Potential and Limitations

  • Antibiotic Synergy: dsbB inhibitors could potentiate β-lactams by disrupting disulfide-dependent antibiotic resistance mechanisms .

  • Zoonotic Relevance: As P. multocida causes human infections via animal bites, dsbB-based vaccines may reduce zoonotic transmission .

  • Challenges: No direct toxicity data exist for dsbB in humans. Current formulations are restricted to research use .

Future Research Directions

  1. Structural Studies: Cryo-EM or crystallography to map redox-active sites for inhibitor design.

  2. Adjuvant Optimization: Pairing dsbB with novel adjuvants (e.g., TLR agonists) to enhance immune responses.

  3. Cross-Serotype Efficacy: Testing dsbB conservation across P. multocida serogroups A, B, D, E, F .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dsbB; PM0046; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
dsbB
Target Protein Sequence
MLSFFKTLSTKRSAWFLLFSSALLLEAIALYFQHGMGLAPCVMCIYERVAILGIAFSGLL GLLYPSSMLLRLVALLIGLSSAIKGLMISITHLDLQLYPAPWKQCSAVAEFPETLPLDQW FPALFLPSGSCSEVTWQFLGFSMVQWIVVIFALYTLLLALIFISQVKRLKPKQRRLFH
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: pmu:PM0046

STRING: 272843.PM0046

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida and what diseases does it cause?

Pasteurella multocida is a gram-negative bacterial pathogen responsible for several economically significant diseases in production animals worldwide. These include bovine hemorrhagic septicemia, avian fowl cholera, porcine atrophic rhinitis, and duck cholera (also known as duck hemorrhagic septicemia) . Duck cholera specifically is described as a highly contagious disease with Type A being the predominant pathogenic serotype affecting the duck industry . Despite considerable research efforts, safe and effective vaccines against pasteurellosis remain limited, highlighting the continued need for identifying novel virulence factors and vaccine candidates .

What expression systems are commonly used for recombinant P. multocida proteins?

Based on available research, Escherichia coli is the predominant expression system for recombinant P. multocida proteins. For instance, in vaccine development research, the genes encoding lipoproteins VacJ, PlpE, and the outer membrane protein OmpH from P. multocida strain PMWSG-4 were successfully cloned and expressed as proteins in E. coli . Specifically, these genes were cloned into pET43.1a expression vectors to produce his-tagged fusion proteins, which were then purified for subsequent vaccine formulation and testing . This approach allows for the production of significant quantities of recombinant protein for immunological and functional studies.

How is the immunogenicity of recombinant P. multocida proteins typically evaluated?

Immunogenicity of recombinant P. multocida proteins is evaluated through multiple complementary approaches. In duck models, researchers have measured antibody responses in vaccinated animals, with significant antigenic responses (p<0.005) observed following vaccination with recombinant proteins formulated with adjuvants . Beyond antibody titers, comprehensive evaluation includes challenge studies where vaccinated animals are exposed to virulent P. multocida strains (typically at doses such as 20 LD50) to assess protective efficacy . Additional assessment methods include histopathological examination of tissues to evaluate reduction in damage, and quantification of bacterial loads in various organs using real-time qPCR to determine the vaccine's ability to reduce bacterial colonization .

What cloning and expression strategies are recommended for obtaining functional recombinant P. multocida proteins?

A methodical approach to obtaining functional recombinant P. multocida proteins involves the following steps:

  • Gene identification and amplification: Target genes should be amplified by PCR from P. multocida genomic DNA using specific primers designed based on genomic sequences .

  • Validation: Amplified genes should be validated by DNA sequencing to confirm correct sequence identity .

  • Vector selection: Cloning into appropriate expression vectors (such as pET43.1a) between suitable restriction sites (e.g., SmaI and HindIII) to generate his-tagged fusion proteins .

  • Transformation and expression: Introduction of recombinant plasmids into E. coli expression hosts followed by optimization of induction conditions.

  • Purification: Affinity chromatography utilizing the his-tag for protein purification.

  • Verification: Assessment of purity using SDS-PAGE followed by Coomassie Brilliant Blue staining and Western blot analysis with specific antibodies to confirm identity and antigenicity .

For membrane proteins like DsbB, additional considerations may include optimization of extraction and solubilization conditions to maintain native conformation and function.

How can researchers create and validate isogenic mutants of P. multocida for functional studies?

Creation of isogenic P. multocida mutants follows this methodological approach:

  • Amplification of target gene region: Using PCR with specific primers to amplify the gene and surrounding regions (e.g., a 2.1-kb DNA fragment) .

  • Cloning into an appropriate vector: Such as pWSK129 to generate an initial construct .

  • Disruption of the target gene: Insertion of an antibiotic resistance marker (e.g., tet(M)) at a unique restriction site within the gene .

  • Verification of construct: DNA sequencing to confirm correct insertion of the antibiotic resistance gene .

  • Preparation for transformation: dam methylation of the plasmid prior to electroporation, which enhances transformation efficiency in P. multocida .

  • Transformation and selection: Electroporation into P. multocida followed by selection of recombinants on appropriate antibiotic-containing media .

  • Confirmation of mutation: Verification of correct gene disruption through PCR and functional assays specific to the gene of interest .

This approach allows for the specific disruption of genes like nrfE, enabling researchers to study their function through phenotypic analysis of the mutant strain.

What approaches can be used to identify P. multocida genes that are preferentially expressed during infection?

Several sophisticated techniques have been employed to identify in vivo-expressed genes of P. multocida:

  • In vivo expression technology (IVET): This technique identifies genes that are preferentially expressed during infection by creating promoter-antibiotic resistance gene fusions . The PmIVET system uses a plasmid-based promoter-probe approach with a promoterless kan gene . Genomic fragments are cloned upstream of this gene, creating transcriptional fusions that are introduced into virulent P. multocida strains . After infection and antibiotic treatment, bacteria that survive in vivo but are antibiotic sensitive in vitro are analyzed to identify in vivo-expressed genes .

  • Signature-tagged mutagenesis: This technique uses uniquely tagged transposons to create a library of mutants that can be screened for attenuation in vivo .

  • Whole-genome expression profiling: Using microarrays or RNA-seq to compare gene expression patterns between in vivo and in vitro conditions .

  • Real-time RT-PCR analysis: For quantitative assessment of specific gene expression levels, with housekeeping genes like gyrB used as normalizers .

These methods have successfully identified numerous genes that are upregulated during infection, including metabolic enzymes, biosynthetic enzymes, and outer membrane lipoproteins .

What factors influence the efficacy of recombinant P. multocida proteins as vaccine candidates?

Multiple factors influence the efficacy of recombinant P. multocida proteins as vaccine candidates, as evidenced by research data:

  • Antigen selection: Different recombinant proteins demonstrate varying levels of protection. For example, when challenged with 20 LD50 of P. multocida A:1, rVacJ provided only 33.3% protection, while both rPlpE and rOmpH provided 83.33% protection .

  • Antigen combination: The combination of multiple antigens can significantly enhance protection. A formulation containing rVacJ+rPlpE+rOmpH provided 100% protection, demonstrating synergistic effects .

  • Adjuvant selection: Water-in-oil or oil-coated adjuvants significantly influence immune response development and protection .

  • Dosage: Appropriate dosing (e.g., 100μg/duck) is critical for eliciting sufficient antibody responses .

  • Challenge dose: The protective efficacy assessment depends on challenge dose; higher lethal doses may result in lower protection rates .

  • Previous exposure: Prior exposure to P. multocida antigens may influence immune response development and vaccine efficacy.

Table 1: Protective efficacy of different vaccine formulations against challenge with 20 LD50 of P. multocida A:1

Vaccine FormulationProtection Rate (%)
rVacJ + adjuvant33.3
rPlpE + adjuvant83.33
rOmpH + adjuvant83.33
rVacJ + rPlpE + rOmpH + adjuvant100
Killed vaccine50

How does bacterial load in tissues correlate with vaccine protection against P. multocida?

Bacterial load analysis provides critical insights into vaccine efficacy beyond survival rates. Research demonstrates that effective vaccination significantly reduces bacterial colonization across multiple organs. In ducks vaccinated with recombinant protein formulations, bacterial loads in heart, liver, spleen, lung, and kidney tissues were significantly lower than in control groups (p<0.001) . This reduction in bacterial load directly correlates with reduced histopathological damage in these tissues, suggesting that even partially protective vaccines may limit tissue damage and disease progression .

The correlation between bacterial load and protection appears to be tissue-specific, with some organs showing more pronounced reduction in bacterial burden than others. This differential protection pattern provides important information about the mechanisms of immunity against P. multocida and potential target tissues for therapeutic interventions. Quantitative real-time PCR methods measuring CFU/mL in tissue samples serve as a reliable metric for assessing vaccine efficacy beyond simple survival rates .

How do the mechanisms of protection differ between recombinant protein subunit vaccines and killed whole-cell vaccines for P. multocida?

Research indicates significant differences in protection mechanisms between recombinant protein subunit vaccines and killed whole-cell vaccines for P. multocida:

  • Protection efficacy: Combined recombinant protein vaccines (rVacJ+rPlpE+rOmpH) demonstrated superior protection (100%) compared to killed bacterin vaccines (50%) against 20 LD50 challenge in ducks .

  • Clinical manifestations: Ducks vaccinated with killed vaccines showed more severe depression and appetite loss post-challenge compared to those receiving recombinant protein combinations .

  • Mortality timing: In killed vaccine groups, deaths occurred between days 1-5 post-challenge, while in recombinant protein groups (particularly rPlpE and rOmpH), deaths occurred later (days 2-6) or not at all .

  • Immune response: While both vaccine types elicit significant humoral responses with elevated serum IgG levels, the quality and specificity of antibodies likely differ, potentially explaining efficacy variations .

  • Antigen presentation: Subunit vaccines present specific protective epitopes at higher concentrations, potentially inducing more targeted immune responses compared to the diverse but potentially diluted antigens in killed vaccines .

These findings suggest that recombinant protein subunit vaccines, particularly when multiple proteins are combined, can overcome limitations of traditional killed vaccines for P. multocida.

What methods are most effective for assessing the functionality of membrane proteins like DsbB from P. multocida?

When assessing functionality of membrane proteins like DsbB from P. multocida, researchers should consider these methodological approaches:

  • Complementation assays: Testing whether the recombinant protein can restore function in a mutant strain lacking the corresponding gene.

  • Activity assays: For DsbB specifically, measuring disulfide bond formation capability using suitable substrates or partner proteins.

  • Protein-protein interaction studies: Examining interactions with known partners (e.g., DsbA for DsbB) using techniques such as co-immunoprecipitation or bacterial two-hybrid systems.

  • Membrane localization confirmation: Using fractionation studies and Western blot analysis to verify proper membrane localization of the expressed protein.

  • Functional assays in heterologous systems: Expression of the protein in model organisms with corresponding gene knockouts to assess functional complementation.

For membrane proteins specifically, careful consideration of extraction and purification methods is essential to maintain native conformation and functionality, as improper solubilization can lead to loss of function and misinterpretation of results.

What animal models are appropriate for studying P. multocida virulence and vaccine efficacy?

Several animal models have been validated for studying P. multocida virulence and vaccine efficacy:

  • Mouse models: Commonly used for initial virulence studies, typically employing intraperitoneal injection of 6-8 week old female BALB/c mice . These models allow for rapid assessment of bacterial virulence, with monitoring of symptom onset and survival times. Challenge doses are calculated based on LD50 determinations .

  • Duck models: Particularly relevant for studying duck cholera, these models provide a natural host system for evaluating vaccine efficacy against P. multocida A:1 . Ducks can be vaccinated and subsequently challenged intramuscularly with virulent P. multocida strains, followed by monitoring of clinical signs, mortality, and detailed analysis of pathological changes and bacterial loads in tissues .

  • Other natural host models: Depending on the specific P. multocida serotype and disease being studied, other relevant models include chicken models for fowl cholera, bovine models for hemorrhagic septicemia, and porcine models for atrophic rhinitis .

The choice of animal model should be guided by the specific disease manifestation being studied and the P. multocida serotype involved. Assessments typically include:

  • Bacterial recovery from blood or tissues

  • Histopathological examination

  • Bacterial load quantification by real-time PCR

  • Antibody response measurement

  • Clinical sign monitoring and survival analysis

How can researchers optimize experimental design when studying protective immunity against P. multocida?

Optimal experimental design for studying protective immunity against P. multocida requires consideration of several critical factors:

  • Sample size determination: Statistical power calculations should be performed to determine appropriate group sizes that can detect meaningful differences in protection. Studies typically use groups of 5-6 animals per treatment .

  • Control groups inclusion: Essential controls include:

    • Adjuvant-only groups to assess adjuvant effects independent of antigens

    • PBS/untreated groups as negative controls

    • Killed vaccine groups as comparative controls

    • Non-challenged PBS groups as baseline health controls

  • Timing considerations:

    • Primary and booster vaccinations scheduled appropriately (typically 2-week intervals)

    • Challenge performed 14 days after booster for optimal immune response evaluation

    • Time points for sample collection based on disease progression

  • Comprehensive readouts:

    • Clinical signs monitoring (depression, appetite loss)

    • Mortality recording

    • Tissue sampling for histopathology at defined timepoints (e.g., 3 days post-challenge)

    • Bacterial load determination using quantitative PCR

    • Antibody titer measurement

    • Bacterial re-isolation and confirmation from tissues

  • Challenge dose standardization: Using defined multiple of LD50 (e.g., 20 LD50) rather than arbitrary bacterial counts ensures consistency across experiments and laboratories .

Careful experimental design with appropriate controls, timing, and comprehensive evaluation metrics enables robust assessment of protective immunity and facilitates comparison across different vaccine formulations and studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.