Recombinant Pasteurella multocida Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Pasteurella multocida Electron Transport Complex Protein RnfE (rnfE) is a 224-amino-acid (24.8 kDa) protein belonging to the Rnf (Rhodobacter nitrogen fixation) electron transport complex family . This protein is encoded by the rnfE gene (locus tag PM0382) and functions as a subunit of the ion-translocating oxidoreductase complex, which facilitates electron transfer across bacterial membranes . The recombinant form is produced in Escherichia coli with an N-terminal His tag for purification, achieving >90% purity via SDS-PAGE .

Key Molecular Features

PropertyDetail
UniProt IDQ9CNP5
Gene NamePM0382 (synonyms: rnfE)
Protein Length224 amino acids (Full length: 1-224aa)
Molecular Weight~24.8 kDa
Expression SystemE. coli
Purification MethodNi-NTA affinity chromatography
Storage ConditionsLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Role in Electron Transport

The Rnf complex in bacteria typically couples electron flow from reduced ferredoxin to NAD+ or menaquinone, generating ion gradients (e.g., Na+ or H+) for ATP synthesis . In P. multocida, RnfE likely partners with other Rnf subunits (e.g., RnfA, RnfG) to optimize energy metabolism under anaerobic conditions, though direct functional studies in this pathogen remain limited .

Experimental Applications

Recombinant RnfE is primarily used for:

  • Antibody Production: Immunogen for generating polyclonal or monoclonal antibodies.

  • Enzyme-Linked Immunosorbent Assay (ELISA): Quantifying RnfE expression in bacterial cultures .

  • Western Blotting: Detecting native RnfE in P. multocida lysates .

Comparative Analysis of Rnf Complex Subunits

SubunitGeneFunctionExpression SystemReference
RnfEPM0382Ion translocation/redox couplingE. coli
RnfGPMVP_1156Electron transfer via iron-sulfur clustersE. coli

Research Implications

While RnfE’s direct role in P. multocida virulence is uncharacterized, homologs in other pathogens (e.g., Clostridium spp.) are critical for anaerobic respiration and pathogenicity . Upregulation of electron transport genes (e.g., nap, ccm) in hfq mutants suggests regulatory links between Rnf systems and stress adaptation in P. multocida .

Knowledge Gaps and Future Directions

  • Functional Studies: Mechanistic analysis of RnfE’s role in P. multocida energy metabolism and host adaptation.

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve RnfE’s interaction with other Rnf subunits.

  • Vaccine Development: Potential as a subunit vaccine target, given the immunogenicity of outer membrane proteins in P. multocida .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All protein shipments are delivered with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rnfE; PM0382; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM0382
Target Protein Sequence
MDQQSTLANTSTPSVWKTLFWQGVWKNNSTLVQLLGLCPLLAVSNSVTNALGLGIATLFV LICSNTVVSLFRKQIPHEIRIPIYVMIIATTVTVVQLLMNAYTYSLYQSLGIFIPLIVTN CIVIGRAEAFASKNPLSHAMFDGFAMGLGMCLSLVFLGAIREILGNGTLFDGIEHLLGDW AKGLRIELFHLDSHFLLAILPPGAFIGLGLILAIKNVIDQRNKA
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane.
Database Links

KEGG: pmu:PM0382

STRING: 272843.PM0382

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are used for producing recombinant P. multocida RnfE protein?

Recombinant P. multocida RnfE protein is commonly expressed in prokaryotic systems, with E. coli being the predominant expression host. For optimal expression and purification, the full-length P. multocida RnfE (amino acids 1-224) is typically fused to an N-terminal His-tag . This tag facilitates purification through affinity chromatography and can be useful for detection in experimental protocols.

The expression methodology generally follows these steps:

  • Gene cloning into an appropriate expression vector

  • Transformation into competent E. coli cells

  • Induction of protein expression (commonly using IPTG for T7 promoter systems)

  • Cell lysis to release the recombinant protein

  • Purification via His-tag affinity chromatography

  • Quality control assessment through SDS-PAGE (purity >90%)

  • Lyophilization for storage stability

When working with membrane proteins like RnfE, detergent solubilization is often necessary during purification, though specific detergent requirements may vary depending on downstream applications.

How should recombinant P. multocida RnfE protein be stored and handled for optimal stability?

Proper storage and handling of recombinant P. multocida RnfE protein is critical for maintaining its functional integrity and experimental reproducibility. Based on established protocols, the following storage and handling guidelines should be implemented:

  • Long-term storage: Store the lyophilized protein powder at -20°C to -80°C

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly degrade protein quality

  • Prior to opening, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for aliquots intended for long-term storage at -20°C/-80°C

Recommended storage buffer composition:

  • Tris/PBS-based buffer

  • 6% Trehalose

  • pH 8.0

This formulation helps maintain protein stability during freeze-thaw cycles and prevents aggregation or denaturation.

What methods are effective for studying P. multocida RnfE expression during infection models?

Investigating P. multocida RnfE expression during infection requires sophisticated molecular techniques that can capture in vivo dynamics. Several methodological approaches have proven effective:

  • In Vivo Expression Technology (IVET): This approach has successfully identified nrfE as preferentially expressed during infection. IVET creates genomic library fusions to promoterless reporter genes, allowing identification of genes upregulated in vivo .

  • Real-Time Reverse Transcription PCR (RT-qPCR): This method provides quantitative data on nrfE expression levels under different conditions. RT-qPCR analysis has confirmed upregulation of nrfE during infection compared to in vitro growth .

  • Whole-Genome Expression Profiling: Microarray or RNA-seq approaches allow for comprehensive analysis of transcriptional changes, placing nrfE expression in the context of global gene regulation networks.

  • Reporter Gene Constructs: Fusion of the nrfE promoter to reporter genes (e.g., luciferase, GFP) enables real-time monitoring of expression in infection models.

When designing experiments to study RnfE expression, consider the following methodological considerations:

  • Include appropriate housekeeping genes as normalization controls for transcription studies

  • Compare expression under aerobic versus anaerobic conditions

  • Evaluate expression at multiple time points post-infection

  • Consider tissue-specific expression patterns in different infection sites

How can researchers effectively generate and validate P. multocida RnfE mutants?

Creating and validating P. multocida RnfE mutants is a critical approach for understanding protein function. Based on published methodologies, an effective workflow includes:

  • Mutant Construction:

    • Amplify the target region (approximately 2.1 kb) containing the nrfE gene using PCR with specific primers

    • Clone the amplified fragment into a suitable vector (e.g., pWSK129)

    • Insert an antibiotic resistance marker (e.g., tetracycline resistance gene tet(M)) at a unique restriction site within the nrfE sequence

    • Verify the construct by DNA sequencing

    • Methylate the construct if necessary (e.g., dam methylation)

    • Transform into P. multocida via electroporation

    • Select transformants on appropriate antibiotic-containing media

  • Mutant Validation:

    • PCR verification of proper insertion using primers that flank the insertion site

    • Sequencing to confirm disruption of the target gene

    • Functional assays to confirm phenotypic changes:

      • Nitrite reduction assays under both aerobic and anaerobic conditions

      • Comparative growth curves in nitrite-containing media

    • Complementation studies to confirm that phenotypic changes are due to disruption of nrfE

  • Phenotypic Characterization:

    • Assess virulence in appropriate animal models

    • Compare growth rates under various conditions (aerobic, anaerobic, different electron acceptors)

    • Evaluate stress responses and survival under host-mimicking conditions

This methodological approach has successfully demonstrated that P. multocida nrfE is essential for nitrite reduction while showing that nrfE mutants can maintain virulence in mouse models .

What detection methods can be used to identify native P. multocida RnfE in biological samples?

Detection of native P. multocida RnfE in biological samples presents technical challenges due to potentially low expression levels and sample complexity. Several methodological approaches can be employed:

  • Immunological Methods:

    • Western blotting using antibodies against RnfE or epitope tags in recombinant strains

    • Immunohistochemistry for tissue localization

    • ELISA for quantitative detection in processed samples

  • Molecular Detection:

    • RT-qPCR targeting nrfE mRNA (for expression analysis)

    • 5' Taq nuclease assay utilizing minor groove binder technology (similar to methods developed for P. multocida detection)

  • Mass Spectrometry:

    • Targeted proteomics approaches like selected reaction monitoring (SRM)

    • Shotgun proteomics with database matching

When implementing the 5' Taq nuclease assay approach, researchers should consider the following methodological details:

  • Design primers and probes specific to unique regions of the nrfE gene

  • Include appropriate controls to ensure specificity

  • Validate the assay using known positive and negative samples

  • Establish detection limits (approximately 10 CFU per reaction has been achieved for P. multocida detection)

This molecular detection approach provides greater sensitivity than conventional culture methods and can detect P. multocida directly from field samples without prior cultivation .

How does RnfE function differ between Pasteurella multocida and other bacterial species?

Understanding the functional differences of RnfE between P. multocida and other bacterial species requires comparative analysis across multiple dimensions:

  • Sequence Homology Analysis:
    While P. multocida RnfE shares functional similarity with E. coli RnfE as part of the formate-dependent nitrite reductase system, there are important species-specific variations. In E. coli, the Rnf complex is involved in utilizing nitrite as an electron acceptor during anaerobic growth. In P. multocida, research has demonstrated that nrfE is essential for nitrite reduction under both aerobic and anaerobic conditions , suggesting potential functional adaptations.

  • Expression Pattern Differences:
    P. multocida nrfE is upregulated during infection, as identified through in vivo expression technology . This suggests a potential role in virulence or adaptation to host environments that may differ from other species where RnfE functions primarily in standard anaerobic metabolism.

  • Mutant Phenotype Comparison:

    SpeciesNitrite ReductionVirulence ImpactGrowth Impact
    P. multocidaEliminated in nrfE mutantsMinimal (mutants remain virulent)Strain-dependent
    E. coliAffected in anaerobic conditionsNot applicableGrowth defects under anaerobic conditions
  • Methodological Approach for Comparative Studies:

    • Heterologous expression of P. multocida RnfE in other bacterial species

    • Complementation experiments with RnfE from different species

    • Structural modeling to identify functional domains

    • Site-directed mutagenesis of conserved residues to identify critical functional elements

This comparative analysis reveals that while the general function of RnfE in electron transport is conserved, P. multocida has evolved specific adaptations that may relate to its pathogenic lifestyle and host interaction patterns.

What are the implications of P. multocida RnfE in bacterial pathogenesis and host-pathogen interactions?

The role of P. multocida RnfE in pathogenesis and host-pathogen interactions presents an intriguing research area with several methodological considerations:

  • Expression During Infection:
    Research using in vivo expression technology has identified nrfE as preferentially expressed during infection , suggesting a potential role in host adaptation. This upregulation may indicate:

    • Response to host-specific environmental cues

    • Adaptation to nutrient availability within host tissues

    • Potential role in evading host defense mechanisms

  • Virulence Assessment:
    Interestingly, P. multocida nrfE mutants remain virulent in mouse models despite being unable to reduce nitrite . This finding indicates that:

    • Nitrite reduction is not essential for virulence in the tested model

    • Alternative metabolic pathways may compensate for nrfE deficiency

    • RnfE's role may be context-dependent or host-specific

  • Metabolic Adaptation:
    The ability to utilize nitrite as an electron acceptor may provide P. multocida with metabolic flexibility in different host microenvironments. Methodological approaches to investigate this include:

    • Comparative growth studies in tissue-mimicking media

    • Metabolomic profiling of wild-type versus nrfE mutants

    • In vivo imaging to track bacterial metabolism during infection

  • Research Applications:
    Understanding RnfE's role in pathogenesis could inform:

    • Development of novel detection methods for P. multocida infections

    • Identification of potential therapeutic targets

    • Rational attenuation strategies for vaccine development

When designing experiments to investigate these aspects, researchers should consider:

  • Using multiple animal models to account for host-specific differences

  • Employing tissue-specific infection models that reflect natural infection routes

  • Combining transcriptomic and proteomic approaches for comprehensive analysis

  • Including appropriate controls for environmental variables (oxygen tension, pH, etc.)

How can contradictions in experimental data regarding P. multocida RnfE be resolved and analyzed?

Researchers investigating P. multocida RnfE may encounter seemingly contradictory experimental results across different studies or experimental conditions. Resolving these contradictions requires systematic methodological approaches:

  • Identification of Potential Contradiction Sources:

    • Strain-specific genetic variations in P. multocida isolates

    • Differences in experimental conditions (temperature, media composition, oxygen levels)

    • Variations in detection methods and sensitivities

    • Differences in animal models or infection routes

  • Methodological Framework for Resolution:

    • Standardized reporting of experimental parameters

    • Side-by-side comparison using identical protocols

    • Multi-laboratory validation studies

    • Meta-analysis of published data with statistical assessment

  • Contradiction Analysis Techniques:
    The Stanford Contradiction Corpus methodology provides a framework for analyzing textual contradictions in scientific literature . Adapting this approach for experimental contradictions involves:

    • Classification of contradiction types (direct vs. indirect)

    • Identification of presupposition failures

    • Analysis of negation contexts

    • Evaluation of information granularity differences

  • Practical Resolution Example:
    If two studies report different effects of RnfE mutation on virulence, consider:

    Study ParameterStudy AStudy BResolution Approach
    P. multocida strainAvian isolateMammalian isolateSequence both strains' nrfE and compare
    Animal modelMouseChickenTest both strains in both models
    Infection routeIntraperitonealRespiratoryCompare tissue-specific gene expression
    Virulence measureMortalityBacterial loadUse multiple virulence measures
  • Data Integration Methods:

    • Bayesian analysis to incorporate prior knowledge

    • Machine learning approaches to identify patterns across datasets

    • Network analysis to place contradictory results in biological context

By employing these systematic approaches, researchers can transform apparent contradictions into opportunities for deeper understanding of contextual factors affecting RnfE function and expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.