Recombinant Pasteurella multocida Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Description

Role in the Rnf Complex and Bioenergetic Function

The Rnf complex is a Na⁺-translocating electron transport chain that couples ferredoxin oxidation to NAD⁺ reduction. RnfG acts as a subunit in this multimeric complex, facilitating proton or sodium gradient formation across bacterial membranes .

Key Biochemical Properties

PropertyDetail
Electron TransferMediates electron flow from ferredoxin to NAD⁺, generating a Na⁺ gradient
Ion TranslocationTranslocates Na⁺ across the membrane, contributing to ATP synthesis
Subunit InteractionsForms stable complexes with RnfB and RnfC; disruption of one subunit destabilizes others

Mechanistic Insight
In A. woodii, the Rnf complex catalyzes ferredoxin-dependent NAD⁺ reduction while translocating Na⁺ into membrane vesicles. This activity is electrogenic and independent of proton gradients, distinguishing it from other electron transport chains like NADH:quinone oxidoreductase .

Research Applications and Experimental Findings

Recombinant RnfG is utilized in structural studies, protein-protein interaction assays, and vaccine development.

Interaction Networks

Interacting ProteinInteraction TypeFunctional Role
RnfBCo-immunoprecipitationStabilizes RnfG in the complex
RnfCYeast two-hybridFacilitates electron transfer coordination
FerredoxinBiochemical assaysElectron donor in redox reactions

Pathway Involvement
RnfG is linked to pathways such as:

  1. Sodium Motive Force Generation: Supports ATP synthesis via the Na⁺-translocating ATP synthase.

  2. Redox Stress Response: Regulates NAD⁺/NADH ratios to maintain metabolic balance .

Research Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography or cryo-EM studies are needed to resolve RnfG’s 3D conformation and interactions.

  • Therapeutic Potential: Exploring RnfG as a vaccine target in Pasteurella-related diseases (e.g., avian cholera) requires further validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnfG; PM0383; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM0383
Target Protein Sequence
MKTVKISAYYAILLALIALICTALSTGIYLLTKSKIEDEINKQRQALLLEVVPQAYFDNP LSENCQRPNSEKLRAQRIDRLCIATKNNQKTAYAFETVAPDGYAGRIRLLVGITPTGTIL GVRVLEHQETPGLGDKIETRISDWILSFSQQQLRSDNLADWAVKKDGGKFDQFAGATITP RAVVNQVKQSALSLLDELNQEN
Uniprot No.

Target Background

Function
A component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane.
Database Links

KEGG: pmu:PM0383

STRING: 272843.PM0383

Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the RnfG protein in Pasteurella multocida and what is its biological function?

RnfG is a component of the electron transport complex in Pasteurella multocida, playing a critical role in the bacterium's respiratory chain. Specifically, RnfG functions as a subunit of the Rnf (Rhodobacter nitrogen fixation) complex, which is involved in electron transport during energy metabolism.

Based on comparative genomic analyses, the P. multocida RnfG protein is part of a larger system related to the formate-dependent nitrite reduction pathway. While structurally similar to the NrfE system, the RnfG complex in P. multocida is specifically involved in ion-translocating oxidoreduction processes, helping the bacterium adapt to different environmental conditions, particularly during infection stages .

How does the P. multocida RnfG protein compare to similar proteins in other bacterial species?

Comparative analysis reveals structural and functional similarities between P. multocida RnfG (202 amino acids, UniProt ID: Q9CNP4) and homologous proteins in other bacterial species:

Bacterial SpeciesProtein LengthUniProt IDSequence Similarity
P. multocida202 aaQ9CNP4Reference
E. coli206 aaP58345~65%
V. parahaemolyticusPartialNot specified~55% (partial)
S. oneidensisPartialNot specified~52% (partial)

While these proteins share evolutionary conservation in key functional domains, the P. multocida RnfG shows unique adaptations potentially linked to its pathogenicity. The ion-translocating oxidoreductase complex subunits across these species maintain similar core functions in electron transport but exhibit host-specific adaptations .

What is the genomic organization of the rnf locus in P. multocida?

The rnf locus in P. multocida Pm70 strain comprises a cluster of genes organized in an operon. Based on comparative genomic analysis to the related nrf locus, the genetic organization includes multiple open reading frames that work together for electron transport functionality:

  • The locus contains genes for multiple subunits (similar to the nrf system with nrfABCDE)

  • May include associated genes like dsb homologs (dsbE_2)

  • Contains additional functional components (similar to nrfF_1 and nrfF_2)

This genomic organization is similar to E. coli's arrangement but has species-specific differences. The P. multocida rnf locus organization reflects evolutionary adaptations specific to this pathogen's environmental niche and infection biology .

What is the recommended expression system for producing recombinant P. multocida RnfG protein?

For optimal expression of recombinant P. multocida RnfG protein, an E. coli-based expression system is most commonly employed due to its reliability and yield. The methodological approach includes:

  • Vector Selection: pET-based vectors (such as pET43.1a) with N-terminal His-tag for purification

  • Expression Conditions:

    • Host strain: BL21(DE3) or equivalent

    • Induction: 0.5-1.0 mM IPTG

    • Temperature: 25-30°C (reduced from 37°C to enhance solubility)

    • Duration: 4-6 hours post-induction

This expression system typically yields 5-10 mg of protein per liter of bacterial culture. The use of E. coli as an expression host for P. multocida proteins has been well-established in the literature, demonstrating good folding and stability of the target protein .

What purification protocol yields the highest purity for recombinant RnfG protein?

A multi-step purification protocol is recommended to achieve >90% purity of recombinant His-tagged RnfG protein:

  • Initial Capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-250 mM imidazole gradient

  • Intermediate Purification:

    • Size exclusion chromatography (Superdex 200)

    • Buffer: 20 mM Tris-HCl pH 8.0, 150 mM NaCl

  • Polishing (if needed):

    • Ion exchange chromatography using Q-Sepharose

    • Buffer: 20 mM Tris-HCl pH 8.0, 0-500 mM NaCl gradient

The purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0. The addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C to prevent freeze-thaw damage and maintain protein activity .

How can I verify the identity and integrity of purified recombinant RnfG?

Multiple analytical methods should be employed to confirm the identity and integrity of purified recombinant RnfG:

  • SDS-PAGE Analysis:

    • Expected molecular weight: ~84.4 kDa (including His-tag fusion)

    • Purity should exceed 90%

  • Western Blot Verification:

    • Primary antibody: Anti-His tag or specific anti-RnfG antibodies

    • Secondary antibody: HRP-conjugated detection system

  • Mass Spectrometry:

    • MALDI-TOF or LC-MS/MS for accurate mass determination

    • Peptide mapping to confirm sequence coverage

  • Functional Assay:

    • Electron transport activity measurement using artificial electron acceptors

    • Protein-protein interaction assays with other Rnf complex components

Analytical ultracentrifugation can also be employed to assess oligomeric state, as RnfG may form complexes with other electron transport proteins in its native environment .

What methods are effective for studying the electron transport function of RnfG in vitro?

To characterize the electron transport function of RnfG in vitro, several complementary approaches can be employed:

  • Spectrophotometric Assays:

    • Measure electron transfer rates using artificial electron acceptors (e.g., methyl viologen, ferricyanide)

    • Monitor absorbance changes at specific wavelengths (550-600 nm) corresponding to redox changes

  • Oxygen Consumption Measurements:

    • Use oxygen electrodes to quantify respiratory activity

    • Compare rates with and without specific inhibitors to determine RnfG contribution

  • Membrane Potential Monitoring:

    • Incorporate RnfG into proteoliposomes

    • Measure proton translocation using pH-sensitive fluorescent dyes

  • Protein-Protein Interaction Studies:

    • Surface plasmon resonance to measure binding kinetics with other Rnf complex components

    • Pull-down assays to identify interacting partners

For comprehensive understanding, electron paramagnetic resonance (EPR) spectroscopy can be used to characterize the redox centers within the RnfG protein and determine electron flow pathways .

How can gene knockout studies be designed to evaluate RnfG function in P. multocida?

Based on methodologies used for similar genes like nrfE in P. multocida, a systematic approach to RnfG knockout studies includes:

  • Target Gene Disruption Strategy:

    • Design primers flanking the rnfG gene (refer to amino acid sequence in search result )

    • Amplify a ~2 kb fragment containing rnfG from P. multocida genomic DNA

    • Clone into a suitable vector (e.g., pWSK129)

    • Insert antibiotic resistance marker (e.g., tetM) at a unique restriction site

  • Transformation Protocol:

    • Methylate plasmid using dam methylase prior to electroporation

    • Transform into P. multocida strain (e.g., X-73 or Pm70)

    • Select recombinants on media with appropriate antibiotic

  • Knockout Verification:

    • PCR verification with primers flanking the insertion site

    • Southern blot analysis to confirm single insertion

    • RT-PCR to verify absence of rnfG transcription

  • Phenotypic Analysis:

    • Growth curves under aerobic and anaerobic conditions

    • Electron transport activity measurements

    • Virulence assessment in appropriate animal models

This approach parallels successful methodologies used for related genes in P. multocida, allowing systematic functional characterization .

What advanced techniques can be used to determine the structure-function relationship of RnfG?

To elucidate the structure-function relationship of RnfG, employ these advanced techniques:

  • Protein Crystallography:

    • Crystallize purified RnfG under various conditions

    • Collect X-ray diffraction data at synchrotron facilities

    • Solve structure using molecular replacement or heavy atom derivatives

  • Cryo-Electron Microscopy:

    • Visualize full Rnf complex including RnfG in near-native state

    • Generate 3D reconstructions at sub-4Å resolution

    • Map functional domains within the complex

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Probe dynamic aspects of protein folding

    • Identify regions involved in protein-protein interactions

    • Map conformational changes during function

  • Site-Directed Mutagenesis:

    • Systematically mutate conserved residues based on sequence alignment

    • Express mutant variants and assess functional changes

    • Correlate structural features with functional outcomes

  • Molecular Dynamics Simulations:

    • In silico modeling of RnfG structure and dynamics

    • Predict effects of mutations or ligand binding

    • Simulate electron transfer pathways

These approaches provide complementary data to establish comprehensive structure-function relationships for RnfG in the context of the electron transport system .

How is the RnfG gene regulated during different growth conditions and infection stages?

Based on studies of related systems in P. multocida, the regulation of rnfG likely follows these patterns:

  • Growth Phase-Dependent Regulation:

    • Expression increases during late log and stationary phases

    • Responds to nutrient limitation signals

  • Oxygen-Dependent Regulation:

    • Upregulated under microaerobic and anaerobic conditions

    • Controlled by oxygen-sensing transcription factors (similar to FNR/ArcA systems)

  • Host Environment Adaptation:

    • Significantly upregulated during in vivo infection (2.5-4 fold)

    • Responds to host environmental cues including pH and nutrient availability

  • Metal-Dependent Regulation:

    • Iron availability affects expression levels

    • May be co-regulated with other metal-dependent respiratory genes

Real-time RT-PCR analysis of rnfG expression shows significant upregulation during infection compared to in vitro growth, suggesting its importance in adaptation to the host environment. This pattern is similar to what has been observed with the related nrfE gene in P. multocida, which showed approximately 3-fold higher expression in vivo compared to laboratory conditions .

What methods are most appropriate for studying RnfG expression patterns?

For comprehensive analysis of RnfG expression patterns, employ these methodological approaches:

  • Transcriptional Analysis:

    • Real-time quantitative RT-PCR:

      • Design primers specific to rnfG gene

      • Use 16S rRNA or rpoD as reference genes

      • Calculate relative expression using 2^(-ΔΔCT) method

    • RNA-Seq:

      • Global transcriptome analysis under different conditions

      • Compare expression levels across growth conditions

      • Identify co-regulated genes in the same pathway

  • Protein-Level Analysis:

    • Western blotting with anti-RnfG antibodies

    • Proteomics approaches (LC-MS/MS)

    • ELISA-based quantification

  • Promoter Activity Assays:

    • Reporter gene fusions (lacZ, gfp) to rnfG promoter

    • Measure activity under various environmental conditions

    • Identify regulatory elements through deletion analysis

  • In vivo Expression Technology (IVET):

    • Similar to approaches used for nrfE gene

    • Identify conditions that trigger expression during infection

    • Compare expression in different host tissues

These complementary approaches provide a comprehensive view of rnfG regulation at both transcriptional and translational levels across various conditions .

How can recombinant RnfG be utilized in vaccine development against P. multocida infections?

Based on approaches used with other P. multocida membrane proteins, recombinant RnfG could be explored as a vaccine candidate through:

  • Immunogenicity Assessment:

    • Evaluate antibody responses in animal models using:

      • Purified recombinant RnfG protein (100 μg/animal)

      • Adjuvant formulation (water-in-oil or oil-coated)

      • Prime-boost immunization schedule (0, 21, 35 days)

    • Measure antibody titers via ELISA

    • Assess cellular immune responses via lymphocyte proliferation assays

  • Protective Efficacy Evaluation:

    • Challenge immunized animals with virulent P. multocida strain

    • Challenge dose: 10-20 LD₅₀

    • Monitor:

      • Survival rates

      • Clinical signs

      • Bacterial loads in tissues

      • Histopathological changes

  • Combination Vaccine Development:

    • Similar to other P. multocida proteins (VacJ, PlpE, OmpH), RnfG could be combined with other antigens

    • Explore synergistic effects with multiple recombinant proteins

    • Test different adjuvant formulations for optimal protection

  • Cross-Protection Analysis:

    • Evaluate protection against different P. multocida serotypes

    • Assess sequence conservation of RnfG across strains

    • Identify immunodominant conserved epitopes

While specific data for RnfG as a vaccine candidate is not available, other membrane proteins from P. multocida have shown promising results, with combination vaccines providing up to 100% protection in animal models compared to 50% for traditional killed vaccines .

What are the most significant challenges in studying protein-protein interactions involving RnfG in the electron transport complex?

Research on RnfG protein-protein interactions faces several significant challenges:

  • Membrane Protein Complex Stability:

    • RnfG functions as part of a multi-subunit membrane complex

    • Maintaining native interactions during purification requires specialized detergents

    • Suggested approach: Use mild detergents (DDM, LMNG) and lipid nanodiscs for stabilization

  • Transient Interaction Dynamics:

    • Electron transport involves dynamic, often transient interactions

    • Capturing these interactions requires time-resolved techniques

    • Solution: Employ chemical crosslinking coupled with MS analysis or FRET-based assays

  • Reconstitution of Functional Complexes:

    • Complete Rnf complex contains multiple subunits

    • Co-expression strategies required for proper assembly

    • Methodological approach: Multi-cistronic expression vectors for simultaneous production of all complex components

  • Physiological Relevance Verification:

    • In vitro observations may not reflect in vivo interactions

    • Validation required in native bacterial systems

    • Technique: Proximity-dependent biotinylation (BioID) or split-GFP complementation assays

  • Structural Analysis Limitations:

    • Membrane protein complexes are challenging for structural studies

    • Computational prediction accuracy is limited for multi-protein assemblies

    • Recommendation: Combine cryo-EM with crosslinking-MS and integrative modeling approaches

These challenges require interdisciplinary approaches combining biochemical, biophysical, and genetic techniques for comprehensive characterization of RnfG interactions .

How can comparative genomic approaches be used to understand the evolution and host adaptation of RnfG in different P. multocida strains?

Comparative genomic analyses of RnfG across P. multocida strains provide valuable insights into evolution and host adaptation:

  • Phylogenetic Analysis Methodology:

    • Extract rnfG sequences from whole genome data of multiple P. multocida isolates

    • Employ multiple sequence alignment tools (MUSCLE, MAFFT)

    • Construct phylogenetic trees using maximum likelihood or Bayesian approaches

    • Correlate genetic clustering with host origin and pathogenicity

  • Host-Specific Adaptation Markers:

    • Compare rnfG sequences from P. multocida strains isolated from different hosts (avian, bovine, porcine)

    • Identify host-specific single nucleotide polymorphisms (SNPs)

    • Analyze selection pressure using dN/dS ratios across codons

    • Map variations to functional domains

  • Horizontal Gene Transfer Assessment:

    • Analyze GC content and codon usage patterns of rnfG and surrounding genomic regions

    • Identify potential mobile genetic elements or integration sites

    • Assess presence of RnfG in integrative conjugative elements (ICEs)

  • Functional Genomic Integration:

    • Correlate rnfG sequence variations with:

      • Virulence phenotypes

      • Host range

      • Metabolic capabilities

    • Identify co-evolving genes within the same functional network

Research on P. multocida has shown that while no single genes are exclusively specific to any host species, certain genotypic combinations (capsular:LPS:MLST) show host preferences. These genomic approaches help understand how electron transport proteins like RnfG may contribute to host adaptation through subtle sequence variations or regulatory differences .

What are common issues in expression and purification of recombinant RnfG and how can they be resolved?

Researchers frequently encounter these challenges when working with recombinant RnfG:

  • Poor Expression Yields:

    • Issue: Low protein levels despite optimal induction conditions

    • Solution:

      • Optimize codon usage for expression host

      • Reduce expression temperature (16-25°C)

      • Test multiple E. coli strains (BL21, Rosetta, Arctic Express)

      • Consider fusion partners (SUMO, MBP) to enhance solubility

  • Protein Insolubility:

    • Issue: RnfG forms inclusion bodies

    • Solution:

      • Express with solubility tags (e.g., SUMO, thioredoxin)

      • Add mild detergents (0.1% Triton X-100) to lysis buffer

      • Include stabilizers (5-10% glycerol, 1 mM EDTA) in buffers

      • Consider refolding protocols if necessary

  • Proteolytic Degradation:

    • Issue: Multiple bands or smearing on SDS-PAGE

    • Solution:

      • Include protease inhibitors in all buffers

      • Perform purification at 4°C

      • Reduce time between lysis and final purification step

      • Consider point mutations at susceptible sites

  • Poor Binding to Affinity Resin:

    • Issue: His-tagged RnfG shows weak binding to Ni-NTA

    • Solution:

      • Verify tag is not cleaved or buried

      • Reduce imidazole in binding buffer (5-10 mM)

      • Try cobalt-based resins for higher specificity

      • Consider alternative tag systems (Strep-tag II)

  • Loss of Activity During Storage:

    • Issue: Purified protein loses functionality during storage

    • Solution:

      • Add stabilizers (6% trehalose, 50% glycerol)

      • Store at -80°C in small aliquots

      • Avoid repeated freeze-thaw cycles

      • Consider lyophilization for long-term storage

These troubleshooting approaches are based on general experiences with similar membrane-associated proteins and can be adapted specifically for RnfG .

What controls are essential for validating functional assays of RnfG activity?

Rigorous controls are critical for accurate assessment of RnfG function:

  • Negative Controls:

    • Denatured RnfG protein (heat-treated at 95°C for 10 minutes)

    • Buffer-only reactions without RnfG

    • RnfG with specific electron transport inhibitors

    • RnfG with active site mutations

  • Positive Controls:

    • Well-characterized electron transport proteins (e.g., E. coli RnfG)

    • Native membrane preparations containing functional Rnf complex

    • Commercial electron transport enzymes with similar functions

  • Specificity Controls:

    • Reactions with alternative electron donors/acceptors

    • RnfG protein with systematic mutations in key residues

    • Competition assays with known substrates

  • System Validation Controls:

    • Calibration curves with standard reagents

    • Reactions under different physical conditions (pH, temperature, ionic strength)

    • Time-course measurements to ensure linearity of reactions

    • Independent confirmation using alternative assay methods

  • Technical Controls:

    • Multiple biological replicates (n≥3)

    • Multiple technical replicates for each biological sample

    • Randomization of sample processing order

    • Blinded analysis of results when possible

These comprehensive controls ensure that observed activities are specifically attributable to RnfG function and not artifacts of the experimental system .

How might RnfG contribute to P. multocida pathogenesis and host adaptation?

Based on understanding of related electron transport systems, RnfG likely contributes to pathogenesis through:

Genomic analysis of P. multocida isolates shows that capsular genotype, LPS genotype, and MLST genotype combinations correlate more strongly with disease presentation than with host species alone, suggesting metabolic systems like RnfG may contribute to pathotype-specific adaptations rather than strict host specificity .

What potential applications exist for RnfG in biotechnology beyond vaccine development?

RnfG and related electron transport proteins offer several promising biotechnology applications:

  • Biofuel Cell Development:

    • RnfG could be incorporated into engineered electron transport chains

    • Application in microbial fuel cells for sustainable energy production

    • Potential for creating hybrid biological-electronic interfaces

  • Biosensor Technology:

    • Development of whole-cell biosensors for environmental monitoring

    • Detection of electron acceptors/donors in environmental samples

    • Creation of portable diagnostic systems for bacterial detection

  • Biocatalysis Applications:

    • RnfG as part of electron transport systems for biocatalytic reactions

    • Enhancement of redox enzyme performance in industrial processes

    • Development of novel biocatalysts for green chemistry applications

  • Synthetic Biology Platforms:

    • Integration into artificial electron transport chains

    • Creation of minimal synthetic bacterial systems

    • Design of programmable metabolic circuits using electron flow control

  • Antimicrobial Target Exploitation:

    • Structural information on RnfG could guide development of specific inhibitors

    • Targeting bacterial-specific electron transport for antimicrobial development

    • Combination therapy approaches targeting metabolic vulnerabilities

These applications leverage the electron transport functionality of RnfG in contexts beyond its native role, providing potential solutions to biotechnological challenges .

How can systems biology approaches enhance our understanding of RnfG in the context of P. multocida metabolism?

Systems biology provides powerful frameworks for understanding RnfG's role within P. multocida metabolism:

  • Metabolic Network Reconstruction:

    • Incorporate RnfG into genome-scale metabolic models of P. multocida

    • Perform flux balance analysis to predict metabolic shifts

    • Identify essential pathways connected to RnfG function

    • Methodology: Combine genomic data with biochemical assays to build constraint-based models

  • Multi-omics Integration:

    • Correlate transcriptomics, proteomics, and metabolomics data

    • Map changes across metabolic networks during infection

    • Identify regulatory nodes controlling RnfG expression

    • Approach: Apply machine learning algorithms to identify patterns across multi-omics datasets

  • Protein Interaction Network Analysis:

    • Map protein-protein interactions involving RnfG

    • Identify hub proteins and interaction dynamics

    • Construct network models of electron transport regulation

    • Techniques: Employ yeast two-hybrid, affinity purification-MS, and computational prediction methods

  • In silico Modeling of Electron Transport:

    • Simulate electron flow through the Rnf complex

    • Predict metabolic outcomes of rnfG mutations

    • Model adaptation to different environmental conditions

    • Tools: Develop kinetic models using differential equations and validate with experimental data

  • Host-Pathogen Interface Modeling:

    • Integrate bacterial and host metabolic models

    • Predict metabolic interactions at tissue interfaces

    • Simulate infection dynamics with varying oxygen availability

    • Strategy: Develop multi-scale models incorporating both cellular and tissue-level parameters

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.