Recombinant Pasteurella multocida Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

As a membrane-embedded protein component, frdD exhibits distinct biochemical properties that facilitate its anchoring function. The recombinant form is typically stored in a Tris-based buffer containing 50% glycerol, specifically optimized to maintain protein stability . Storage recommendations include keeping the protein at -20°C, with extended storage at -20°C or -80°C as needed. Working aliquots may be maintained at 4°C for up to one week, though repeated freezing and thawing cycles should be avoided to preserve protein integrity .

Table 1: Key Properties of Recombinant P. multocida frdD

PropertySpecificationReference
Amino Acid Length116 residues
UniProt AccessionQ9CP59
Locus NamePM0198
Expression Region1-116 (full length)
Storage BufferTris-based with 50% glycerol
Recommended Storage-20°C (short-term), -20°C or -80°C (long-term)
Working Storage4°C for up to one week

Primary Structure Analysis

The primary structure of P. multocida frdD reveals a protein rich in hydrophobic amino acids, consistent with its role as a membrane anchor for the fumarate reductase complex. Sequence analysis indicates multiple transmembrane domains that facilitate integration into the bacterial membrane, providing stability to the entire enzyme complex. These hydrophobic regions likely form alpha-helical structures that span the lipid bilayer, positioning the catalytic components of the complex appropriately for electron transfer.

Genetic Context and Organization

The frdD gene exists within a larger operon structure that typically includes all components of the fumarate reductase complex. This genetic organization ensures coordinated expression of the entire enzyme complex under appropriate metabolic conditions. In P. multocida, the fumarate reductase genes are likely regulated in response to oxygen availability, with increased expression under anaerobic or microaerobic conditions that necessitate alternative electron acceptors like fumarate.

Contribution to Anaerobic Respiration

The primary function of the fumarate reductase complex, including its frdD subunit, is to enable anaerobic respiration by catalyzing the reduction of fumarate to succinate. This reaction represents a critical step in anaerobic electron transport, allowing bacteria to generate energy in oxygen-limited environments. The frdD subunit specifically serves to anchor the catalytic components of the enzyme complex to the bacterial membrane, facilitating appropriate spatial organization for efficient electron transfer.

In related bacterial species such as Actinobacillus pleuropneumoniae, the frdD gene (APL_1526) has been shown to be upregulated under specific conditions with a fold change of 2.178 . This differential expression highlights the metabolic importance of fumarate reductase components across bacterial species, suggesting similar regulatory mechanisms may operate in P. multocida.

Role in Bacterial Pathogenesis

While direct evidence linking frdD specifically to P. multocida virulence is limited in the current literature, the ability to perform anaerobic respiration represents an important adaptation for bacterial survival within host tissues. Recent pathogenomic analyses of P. multocida strains isolated from human infections have revealed various virulence factors and mobile genetic elements , suggesting complex adaptive mechanisms enable this organism to colonize and infect host tissues. The capacity for anaerobic respiration facilitated by components like frdD likely contributes to bacterial persistence in oxygen-restricted microenvironments encountered during infection.

Table 2: Comparative Expression of frdD and Related Components in Bacterial Species

GeneBacterial SpeciesProtein FunctionFold Change in ExpressionReference
frdDA. pleuropneumoniaeFumarate reductase subunit D2.178
frdAA. pleuropneumoniaeFumarate reductase, flavoprotein subunit2.420
adhIA. pleuropneumoniaeAlcohol dehydrogenase2.992
mqoA. pleuropneumoniaePutative malate:quinone oxidoreductase2.802
ccpA. pleuropneumoniaeCytochrome c peroxidase2.796

Expression Systems and Methodology

The production of recombinant P. multocida frdD typically involves heterologous expression systems, with bacterial hosts like Escherichia coli being commonly employed. The expression construct generally incorporates affinity tags to facilitate downstream purification, though the specific tag type may vary depending on the production process . Expression typically encompasses the full protein sequence (amino acids 1-116) to ensure complete structural and functional integrity .

Purification and Quality Control

Purification of recombinant frdD presents unique challenges due to its hydrophobic, membrane-associated nature. Affinity chromatography represents the primary purification method, leveraging incorporated tags for selective binding. Following purification, quality control measures typically include SDS-PAGE analysis to confirm protein integrity and size, with additional functional assays as needed to verify activity within reconstituted enzyme complexes.

Immunological and Diagnostic Applications

Recombinant frdD serves as an antigen for antibody production, enabling the development of detection methods for P. multocida. ELISA (Enzyme-Linked Immunosorbent Assay) systems utilizing recombinant frdD are available for research purposes , allowing sensitive and specific detection of antibodies against this protein in various sample types. Such immunological tools facilitate both basic research and potential diagnostic applications.

Therapeutic Target Potential

Understanding the structure and function of bacterial fumarate reductase components, including frdD, creates opportunities for developing targeted antimicrobial strategies. Since mammals do not use fumarate as a terminal electron acceptor in energy metabolism, inhibitors specifically targeting bacterial fumarate reductase could potentially offer selective antimicrobial activity with minimal host toxicity. This approach may prove particularly valuable given the increasing prevalence of antibiotic resistance among bacterial pathogens.

Relationship to Other Bacterial Respiratory Enzymes

The fumarate reductase complex represents one of several terminal reductases that facilitate bacterial anaerobic respiration. While functionally related to enzymes like nitrate reductase (NrfC) and dimethylsulfoxide reductase (DmsA), which were observed to have fold changes of 2.250 and 1.934 respectively in A. pleuropneumoniae , fumarate reductase occupies a distinct role in the utilization of fumarate as an electron acceptor. The differential regulation of these various terminal reductases likely reflects adaptation to specific environmental niches and substrate availability.

Evolutionary Conservation and Divergence

Fumarate reductase components, including frdD, show evolutionary conservation across diverse bacterial species, reflecting the fundamental importance of anaerobic respiration in bacterial survival and adaptation. Comparative genomic analyses reveal both conserved domains essential for core functionality and species-specific variations that may reflect adaptation to particular ecological niches or host environments.

Exploration of Regulatory Mechanisms

Further investigation of the regulatory mechanisms controlling frdD expression in P. multocida under various environmental conditions would enhance understanding of how this pathogen adapts to changing oxygen availability during infection. Such studies might reveal potential intervention points for disrupting bacterial adaptation to host environments.

Development of Targeted Therapeutics

The distinct role of fumarate reductase in bacterial metabolism presents an opportunity for developing targeted antimicrobial agents. Structure-guided design of small molecule inhibitors specifically targeting components of the fumarate reductase complex could potentially yield novel therapeutic approaches for combating P. multocida infections in both veterinary and human medicine.

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate any special requirements. Please indicate your desired format during the order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
frdD; PM0198; Fumarate reductase subunit D; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
frdD
Target Protein Sequence
MKDTPKRSNEPVVWLLFGAGTTVSAMFYPVLVLILGFLLPFGLIDPKNIIELIGFLHSPL GKLLLLVLLIFPMWGAMHRIHHGMHDFKIHIPASGVIFYGLSVLYTVLVCFAVFSL
Uniprot No.

Target Background

Function
Anchors the catalytic components of the fumarate reductase complex to the cell membrane, binding quinones.
Database Links

KEGG: pmu:PM0198

STRING: 272843.PM0198

Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the physiological role of the fumarate reductase complex in P. multocida metabolism?

The fumarate reductase complex is fundamentally important for P. multocida's ability to grow and survive under anaerobic or oxygen-limited conditions. This enzyme:

  • Performs the terminal step in anaerobic respiration by using fumarate as the final electron acceptor

  • Catalyzes the reduction of fumarate to succinate while oxidizing quinol to quinone

  • Enables energy generation via electron transport phosphorylation in the absence of oxygen

  • Functions in the opposite direction of succinate dehydrogenase, which operates in aerobic conditions

Research has demonstrated that fumarate is an essential terminal electron acceptor during anaerobic respiration in Pasteurellaceae. In A. pleuropneumoniae (a related organism in the same family), disruption of fumarate metabolism through insertional mutagenesis of fumarate hydratase (fumC) significantly impacts anaerobic growth . By extension, the fumarate reductase complex, including the frdD subunit, likely plays a similarly critical role in P. multocida's ability to adapt to oxygen-limited environments during infection.

What expression systems are most effective for producing recombinant P. multocida frdD?

When expressing recombinant P. multocida frdD, researchers must carefully consider the membrane-associated nature of this protein. Effective expression systems include:

  • E. coli-based systems with membrane protein optimization:

    • BL21(DE3) pLysS with C41/C43 derivatives specifically engineered for membrane protein expression

    • Codon-optimized constructs accounting for the different codon usage between P. multocida and E. coli

    • Fusion tags (such as maltose-binding protein) to enhance solubility while maintaining functionality

  • Cell-free expression systems:

    • Liposome-supplemented cell-free systems that provide a membrane-like environment

    • Nanodiscs incorporation for structural and functional studies

When expressing the recombinant protein, researchers should maintain the native hydrophobic character of frdD while incorporating appropriate purification tags. Expression conditions typically involve:

  • Induction at lower temperatures (16-20°C)

  • Extended expression periods (18-24 hours)

  • Reduced inducer concentrations to prevent formation of inclusion bodies

Storage in 50% glycerol with appropriate buffer composition (Tris-based) at -20°C or -80°C is recommended to maintain stability, with working aliquots kept at 4°C for up to one week to avoid freeze-thaw damage .

What analytical techniques are most appropriate for studying frdD structure and function?

Given the membrane-integrated nature of frdD, specialized techniques are required:

  • Structural analysis:

    • Cryo-electron microscopy for whole complex visualization

    • Solid-state NMR for membrane-embedded structure determination

    • Hydrogen-deuterium exchange mass spectrometry to map membrane-spanning regions

  • Functional analysis:

    • Reconstitution in proteoliposomes to measure electron transfer activity

    • Membrane potential measurements using fluorescent probes

    • Oxygen consumption assays under varying oxygen tensions

    • Enzyme-coupled spectrophotometric assays monitoring fumarate reduction

  • Interaction studies:

    • Crosslinking mass spectrometry to identify interaction interfaces with other subunits

    • Native gel electrophoresis to assess complex formation

    • Blue native PAGE to analyze intact membrane protein complexes

When designing these experiments, researchers should include appropriate controls for membrane protein analysis and ensure that detergent selection during purification maintains the native conformation of the protein.

How can researchers verify the functionality of recombinant frdD protein?

Verification of recombinant frdD functionality requires multiple approaches:

  • Complex assembly assessment:

    • Co-expression with other fumarate reductase subunits to verify proper complex formation

    • Sucrose gradient ultracentrifugation to isolate intact complexes

    • Western blotting to confirm co-purification of all subunits

  • Enzymatic activity:

    • Spectrophotometric assays tracking the conversion of fumarate to succinate

    • Monitoring quinol oxidation coupled to fumarate reduction

    • Comparison of kinetic parameters with native enzyme preparations

  • Membrane integration:

    • Carbonate extraction to confirm proper membrane association

    • Protease protection assays to verify correct topology

    • Fluorescence-based techniques to assess membrane insertion

A robust verification protocol should combine these approaches to ensure that the recombinant protein maintains both structural integrity and catalytic function comparable to the native complex.

How is the frdD gene organized within the P. multocida genome?

The frdD gene in P. multocida is organized within an operon structure that coordinates the expression of all fumarate reductase subunits. Key genomic features include:

  • The frdD gene is designated as PM0198 in the P. multocida strain Pm70 genome

  • The fumarate reductase operon typically contains genes arranged in the order frdABCD

  • Regulatory elements include:

    • A promoter region responsive to anaerobic regulatory factors

    • FNR (fumarate and nitrate reduction) binding sites that activate transcription under low oxygen conditions

    • Potential binding sites for additional transcriptional regulators

The genomic organization ensures coordinated expression of all subunits in stoichiometric amounts, which is essential for proper complex assembly. Comparative genomic analysis shows that while the operon structure is conserved across Pasteurellaceae, subtle differences in regulatory elements may reflect host-specific adaptation patterns .

What methods are most effective for genotyping and analyzing frdD in different P. multocida strains?

For effective genotyping and analysis of frdD across P. multocida strains, researchers should employ:

  • Whole genome sequencing approaches:

    • Short-read sequencing (Illumina) for high accuracy in sequence determination

    • Long-read sequencing (PacBio/Nanopore) for resolving complex genomic regions

    • Hybrid assembly approaches for complete genome reconstruction

  • Targeted sequencing methods:

    • PCR amplification with conserved primers followed by Sanger sequencing

    • MLST (Multilocus Sequence Typing) incorporating frdD as a marker gene

    • Restriction fragment length polymorphism (RFLP) analysis for rapid screening

  • Bioinformatic analysis tools:

    • Multiple sequence alignment to identify conserved and variable regions

    • Phylogenetic tree construction to establish evolutionary relationships

    • Selection pressure analysis to identify potential adaptive sites

Recent developments in P. multocida typing systems combine capsular, lipopolysaccharide, and MLST genotyping for comprehensive strain characterization. The PmGT platform represents an efficient tool for automated genotyping based on whole genome sequence data . While frdD itself is not typically included in standard typing schemes, analysis of its sequence can provide additional insights into strain relationships and host adaptation.

What genetic manipulation strategies can be used to study frdD function in P. multocida?

Several genetic manipulation strategies are available for studying frdD function:

  • Gene deletion and complementation:

    • Allelic exchange mutagenesis to create clean deletions

    • Suicide vector-based approaches for targeted gene replacement

    • Complementation with wild-type or modified alleles to verify phenotypes

  • Transposon mutagenesis systems:

    • Himar1 mariner mutagenesis system developed for Pasteurellaceae

    • Tn5-based systems for random insertional mutagenesis

    • Signature-tagged mutagenesis for high-throughput screening

  • Advanced genetic tools:

    • CRISPR-Cas9 systems adapted for P. multocida

    • Inducible expression systems to control frdD levels

    • Reporter gene fusions to study expression patterns

The application of Himar1 mariner vectors has proven effective for functional genomic analysis in Pasteurellaceae, including the identification of genes involved in anaerobic respiration pathways . For studying frdD specifically, researchers should consider the potential essentiality of this gene under anaerobic conditions and design conditional mutation strategies accordingly.

How does frdD expression contribute to P. multocida virulence and host adaptation?

The contribution of frdD to P. multocida virulence stems from its role in anaerobic metabolism:

  • Adaptation to oxygen-limited host environments:

    • Respiratory tract infections (particularly deep tissue sites)

    • Abscesses and wound infections where oxygen is limited

    • Intracellular survival within phagocytes

  • Metabolic flexibility during infection:

    • Enables energy generation in diverse host microenvironments

    • Facilitates persistence during inflammatory responses

    • Supports growth when competition for oxygen is high

  • Host-specific adaptation patterns:

    • Sequence variations in frdD may reflect adaptation to different host species

    • Expression levels may vary depending on the infection site and host

While not a classical virulence factor like adhesins or toxins, the fumarate reductase complex contributes to pathogenesis by enabling metabolic adaptation. Studies of related Pasteurellaceae have shown that disruption of anaerobic respiration pathways can significantly impact virulence, suggesting that frdD and other components of fumarate respiration play important roles in bacterial survival during infection .

How does frdD function compare across P. multocida strains isolated from different host species?

P. multocida exhibits host-specific strain distribution patterns that may reflect adaptations in metabolic genes like frdD:

Host SourcePredominant GenotypefrdD Sequence ConservationNotable Features
AvianA:L1:ST128High within avian isolatesAdaptations for respiratory tract metabolism
BovineA:L3:ST1, B:L2:ST44High within bovine isolatesVariations may correlate with ruminal environment
PorcineD:L6:ST11, A:L3:ST3Moderate variationSpecific substitutions in membrane-spanning regions
LeporineA:L3:ST12High conservationLimited data available
HumanA:L3:ST1, A:L1Similar to animal isolatesZoonotic transmission maintains core functions

Comparative analysis of P. multocida strains from different hosts shows that while core metabolic functions are preserved, subtle variations in frdD sequence and expression patterns may contribute to host adaptation . These variations may affect:

  • Efficiency of electron transfer under different host-specific conditions

  • Protein stability in different temperature ranges reflecting host body temperatures

  • Interaction with host-specific metabolites or inhibitors

Research approaches to investigate these differences should include comparative biochemical characterization of recombinant frdD from different host-adapted strains under conditions mimicking specific host environments.

What experimental models are most appropriate for studying frdD function during infection?

To effectively study frdD function during infection, researchers should consider:

  • In vitro models:

    • Microaerobic and anaerobic culture systems

    • Host cell co-culture under controlled oxygen tensions

    • Biofilm formation assays to mimic in vivo growth conditions

  • Ex vivo models:

    • Precision-cut lung slices for respiratory infection studies

    • Primary cell cultures from relevant host species

    • Organ-on-chip systems incorporating tissue-specific factors

  • In vivo models:

    • Natural host challenge models when feasible

    • Mouse models with humanized or host-specific tissue factors

    • Comparative infection studies across multiple host species

  • Analytical approaches:

    • In vivo expression technology (IVET) to track frdD expression during infection

    • Dual RNA-seq to simultaneously monitor host and bacterial gene expression

    • Metabolomic analysis to assess changes in fumarate/succinate metabolism

Since P. multocida affects multiple host species, selection of appropriate experimental models should reflect the specific host-pathogen interaction being studied. Control of oxygen levels is particularly important when investigating anaerobic respiration genes like frdD, with oxygen-limited culture systems or tissue penetration models being especially relevant.

How can structural analysis of frdD inform antimicrobial development strategies?

Structural analysis of frdD offers several opportunities for antimicrobial development:

  • Structure-based drug design:

    • Identification of druggable pockets at the interface between frdD and other subunits

    • Targeting of quinone binding sites that interact with the membrane subunits

    • Design of peptidomimetics that disrupt complex assembly

  • Comparative structural approaches:

    • Identifying structural differences between bacterial and mammalian succinate dehydrogenase/fumarate reductase

    • Exploiting unique features of the bacterial enzyme for selective targeting

    • Understanding species-specific structural variations for broad-spectrum activity

  • Rational design strategies:

    • Development of compounds that compete with menaquinol binding

    • Creation of molecules that disrupt the electron transfer pathway

    • Design of membrane-penetrating inhibitors that specifically target anaerobic respiration

High-resolution structural data combined with functional assays can guide development of compounds that specifically inhibit bacterial anaerobic respiration without affecting host metabolism. Since anaerobic respiration is critical for P. multocida persistence in tissues, such inhibitors could effectively reduce bacterial survival during infection.

What is known about post-translational modifications and regulation of frdD?

Research on post-translational modifications of frdD is limited, but several regulatory mechanisms are likely involved:

  • Potential modifications:

    • Membrane integration may involve specific lipid interactions

    • Disulfide bond formation may stabilize protein conformation

    • Proteolytic processing might occur during membrane insertion

  • Expression regulation:

    • Oxygen-dependent transcriptional regulation via FNR or similar factors

    • Nitrate repression systems that coordinate different anaerobic pathways

    • Post-transcriptional regulation through RNA secondary structures

  • Environmental responsiveness:

    • pH-dependent conformational changes affecting complex activity

    • Temperature-responsive expression patterns

    • Nutrient availability signals that coordinate with central metabolism

Methodological approaches to study these aspects include:

  • Quantitative proteomics to identify modifications

  • Reporter gene fusions to monitor expression under varying conditions

  • Site-directed mutagenesis to assess the functional impact of potential modification sites

Understanding these regulatory mechanisms could provide insights into how P. multocida adapts its respiratory chain configuration in response to changing host environments.

How might systems biology approaches advance our understanding of frdD in the context of P. multocida metabolism?

Systems biology approaches offer powerful tools for understanding frdD within the broader metabolic network:

  • Metabolic modeling:

    • Genome-scale metabolic models incorporating anaerobic respiration pathways

    • Flux balance analysis to predict metabolic shifts under oxygen limitation

    • Integration of transcriptomic and proteomic data to refine model predictions

  • Network analysis:

    • Identification of metabolic bottlenecks in anaerobic respiration

    • Prediction of synthetic lethal interactions involving frdD

    • Multi-omics integration to map regulatory networks

  • Comparative systems approaches:

    • Cross-species metabolic models to identify conserved and divergent features

    • Host-pathogen interaction models incorporating metabolic exchanges

    • Ecological models of polymicrobial interactions

These approaches can reveal how fumarate reductase activity is integrated with other aspects of cellular metabolism, potentially identifying:

  • Alternative pathways that complement or compensate for frdD function

  • Critical nodes in metabolic networks that could serve as therapeutic targets

  • Metabolic adaptations that occur during host-specific infections

What emerging technologies could significantly advance frdD research?

Several emerging technologies hold promise for advancing frdD research:

  • Advanced imaging techniques:

    • Cryo-electron tomography for visualizing membrane protein complexes in situ

    • Super-resolution microscopy to track frdD localization in bacterial cells

    • Correlative light and electron microscopy for functional-structural integration

  • High-throughput functional genomics:

    • CRISPR interference screening to identify genetic interactions

    • Transposon sequencing (Tn-Seq) under anaerobic conditions

    • Synthetic biology approaches to engineer optimized fumarate reductase complexes

  • Single-cell techniques:

    • Single-cell RNA-seq to identify subpopulations with differential frdD expression

    • Microfluidics-based approaches for real-time monitoring of metabolic shifts

    • Single-cell metabolomics to track metabolite fluctuations

  • Computational advances:

    • Artificial intelligence for protein structure prediction specific to membrane proteins

    • Molecular dynamics simulations of the entire fumarate reductase complex

    • Machine learning integration with experimental data for predictive modeling

These technologies could address current knowledge gaps regarding the dynamics of frdD expression, localization, and function during infection and adaptation to different host environments.

How might frdD research contribute to broader understanding of bacterial adaptation and evolution?

Research on frdD can provide insights into several fundamental aspects of bacterial biology:

  • Evolutionary adaptation:

    • Understanding selective pressures on respiratory chain components

    • Tracking horizontal gene transfer of respiratory modules across species

    • Identifying signatures of host adaptation in respiratory genes

  • Metabolic flexibility:

    • Elucidating mechanisms of respiratory chain remodeling

    • Understanding the balance between fermentation and anaerobic respiration

    • Mapping metabolic networks that enable survival in diverse environments

  • Host-pathogen co-evolution:

    • Tracking evolutionary changes in respiratory genes across host-adapted strains

    • Identifying patterns of convergent evolution in diverse pathogens

    • Understanding metabolic adaptations to specific host environments

By studying frdD in the context of P. multocida's adaptation to different hosts, researchers can gain insights into the evolutionary processes that shape bacterial metabolism and virulence. This research may reveal general principles applicable to other pathogens with broad host ranges.

What interdisciplinary approaches could yield novel insights about frdD function?

Interdisciplinary collaboration offers opportunities for innovative frdD research:

  • Combining structural biology with synthetic chemistry:

    • Development of chemical probes specific to fumarate reductase components

    • Structure-guided design of inhibitors targeting the membrane subunits

    • Creation of photocrosslinking analogs to map protein-protein interactions

  • Integrating microbiology with systems immunology:

    • Understanding how anaerobic metabolism affects immune recognition

    • Mapping metabolic crosstalk between bacterial and host cells

    • Identifying immunomodulatory effects of bacterial respiratory byproducts

  • Merging microbial ecology with single-cell technologies:

    • Tracking respiratory gene expression in polymicrobial communities

    • Understanding competition for electron acceptors in infection sites

    • Mapping spatial distribution of respiratory activity in biofilms

  • Connecting veterinary medicine with comparative genomics:

    • Correlating frdD sequence variations with host range and virulence

    • Identifying host-specific patterns of anaerobic gene expression

    • Developing targeted treatments based on respiratory chain differences

These interdisciplinary approaches could reveal unexpected connections between anaerobic respiration, virulence, and host adaptation in P. multocida and related pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.