Recombinant Pasteurella multocida Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism and Catalytic Motifs

PlsY belongs to the acyl-phosphate:G3P acyltransferase family. Structural studies on homologs (e.g., Streptococcus pneumoniae) reveal:

  • Membrane topology: Five transmembrane segments with conserved cytoplasmic motifs .

  • Critical residues:

    • Motif 1: Serine (S) and arginine (R) essential for substrate binding.

    • Motif 2: Phosphate-binding loop (Gly-X-Gly) critical for G3P interaction.

    • Motif 3: Histidine (H) and asparagine (N) for structural stability .

  • Inhibition: Noncompetitive inhibition by palmitoyl-CoA .

Role in Bacterial Physiology

PlsY is pivotal for:

  • Phospholipid biosynthesis: Initiates phosphatidic acid formation, a precursor for membrane lipids .

  • Biofilm regulation: Mutants with disrupted lipid biosynthesis in P. multocida show altered biofilm formation, linking PlsY to bacterial persistence in hosts .

Vaccine Development

While PlsY itself is not directly tested as a vaccine antigen, studies on P. multocida recombinant proteins (e.g., PlpE, OmpH) highlight the potential of membrane-associated enzymes as vaccine candidates. For example:

  • Subunit vaccines combining outer membrane proteins (OmpH) and lipoproteins (PlpE) confer 83–100% protection in ducks .

  • Recombinant PlsY could serve as a target for adjuvant-based vaccines due to its surface accessibility and conserved motifs .

Antibiotic Resistance Studies

PlsY’s role in membrane integrity makes it a potential target for disrupting bacterial lipid biosynthesis. Inhibitors targeting its catalytic motifs could reduce virulence .

Future Directions

  • Structural studies: Cryo-EM or X-ray crystallography of P. multocida PlsY to refine catalytic mechanisms.

  • Therapeutic targeting: High-throughput screening for PlsY inhibitors to combat antibiotic-resistant strains .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate this need in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; PM1696; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
plsY
Target Protein Sequence
MSLFAIFYLFLAYLLGSVSSAILLCRLAGLPDPRESGSHNPGATNVLRIGGRWVALSVLL FDMLKGMLPVWLGYYLGLTHFELGMVALGACLGHIFPIFFKFKGGKGVATAFGAIAPISW GVAGSMLGTWLLIFFVSGYSSLSAVMTALLVPFYVWWFKPEFTFPVALVCCLLIYRHHDN IQRLWRGQEDKVWNKLKNKKD
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor but does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: pmu:PM1696

STRING: 272843.PM1696

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.