Recombinant Pasteurella multocida Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pasteurella multocida Large-conductance Mechanosensitive Channel (mscL)

The Recombinant Pasteurella multocida Large-conductance Mechanosensitive Channel (mscL) is a protein derived from the bacterium Pasteurella multocida, a pathogen responsible for various diseases in animals, including fowl cholera and bovine hemorrhagic septicemia . The mscL protein is a mechanosensitive channel that plays a crucial role in maintaining cellular osmotic balance by responding to mechanical stress, such as changes in membrane tension . This protein is expressed in Escherichia coli and is available as a recombinant, His-tagged protein for research purposes .

Structure and Function of mscL

The mscL protein from Pasteurella multocida is a full-length protein consisting of 133 amino acids. It functions as a large-conductance mechanosensitive channel, which opens in response to increased membrane tension, allowing ions to flow out of the cell and thus helping to prevent cell lysis under osmotic stress . The protein's structure includes a characteristic pore-forming domain that is essential for its mechanosensitive properties.

Expression and Purification

The recombinant mscL protein is typically expressed in Escherichia coli using standard molecular biology techniques. The protein is purified and available in a lyophilized powder form, with a purity of greater than 90% as determined by SDS-PAGE . The His-tag facilitates purification using nickel affinity chromatography.

References Frontiers in Immunology: Developing a PmSLP3-based vaccine formulation against Pasteurella multocida. PubMed: Protective immunity conferred by recombinant Pasteurella multocida lipoprotein E. PMC: Immunogenicity and protective efficacy of recombinant proteins from Pasteurella multocida. Creative Biolabs: Recombinant Pasteurella Multocida rmuC Protein. PubMed: Vaccination with Pasteurella multocida recombinant OmpA. Creative Biomart: Recombinant Full Length Pasteurella Multocida Large-Conductance Mechanosensitive Channel (mscL) Protein.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; PM1564; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
mscL
Target Protein Sequence
MSFVKEFREFAMRGNVVDMAVGVIIGGAFGKIVSSLVGDVVMPVLGILTGGVDFKDLSIV LKEAAGEVPAVTLNYGAFIQTVFDFVIIAFAIFLMIKALNKLKREEPKVEEPAEPKLSNE EVLLTEIRDLLKK
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It likely plays a role in regulating cellular osmotic pressure.
Database Links

KEGG: pmu:PM1564

STRING: 272843.PM1564

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida and what is its significance in mechanosensitive channel research?

Pasteurella multocida is a highly versatile Gram-negative, non-motile, penicillin-sensitive coccobacillus that causes various diseases across multiple species. It is classified into five serogroups (A, B, D, E, F) based on capsular composition and 16 somatic serovars (1-16) . While most P. multocida research has focused on pathogenesis and vaccine development, investigation of its membrane proteins including potential mechanosensitive channels represents an emerging area.

P. multocida causes economically significant diseases including:

  • Fowl cholera in avian species

  • Hemorrhagic septicemia in ruminants

  • Progressive atrophic rhinitis in swine

  • Snuffles in rabbits

  • Opportunistic infections in humans following animal bites or scratches

Type A is the predominant pathogenic serotype affecting the duck industry . The bacterium's ability to infect multiple species and cause diverse clinical manifestations makes it an important model for studying host-pathogen interactions and membrane protein function.

What is the mechanosensitive channel of large conductance (MscL) and how does it function in bacterial systems?

The mechanosensitive channel of large conductance (MscL) is a tension-activated membrane protein that functions as an emergency release valve in bacteria, preventing cell lysis during osmotic stress. In bacteria, MscL channels "function as tension-activated pores limiting excessive turgor pressure, with MscL acting as an emergency release valve preventing cell lysis" .

The channel's structure includes:

  • Inner (TM1) and outer (TM2) transmembrane helices

  • A pentagon-shaped gate formed by crossing TM1 helices

  • An amphipathic S1 helix that interacts with lipids during channel expansion

When membrane tension increases due to osmotic stress, MscL undergoes conformational changes that open its pore, allowing rapid efflux of cytoplasmic solutes and water to relieve pressure. The gating mechanism involves "radial dragging force" on the TM helices, which induces "radial sliding of the crossing portions, leading to a gate expansion" . This mechanical response system is crucial for bacterial survival in changing osmotic environments.

What expression systems are most effective for producing recombinant P. multocida proteins for research purposes?

Based on current research, E. coli expression systems remain the gold standard for producing recombinant P. multocida proteins. The methodology typically follows these steps:

  • Gene identification and isolation: Target genes are amplified from P. multocida genomic DNA using PCR with specifically designed primers

  • Vector selection: Common vectors include pET43.1a for His-tagged fusion proteins

  • Transformation: Using competent E. coli strains like DH5α for cloning and BL21(DE3) for expression

  • Expression conditions: Optimized for temperature, induction time, and inducer concentration

  • Purification: Often via affinity chromatography for tagged proteins

For example, a study with P. multocida strain PMWSG-4 successfully expressed and purified recombinant VacJ (84.4 kDa), PlpE (94.8 kDa), and OmpH (96.7 kDa) proteins using this approach . The purified proteins retained antigenic properties, demonstrating proper folding and epitope presentation.

Other expression systems reported in literature include:

  • Yeast expression systems

  • Baculovirus expression systems

  • Mammalian cell expression systems

The choice of expression system should be guided by the specific requirements of the target protein, including post-translational modifications, solubility considerations, and functional requirements.

What structural and functional assays are used to characterize mechanosensitive channels like MscL?

Multiple complementary techniques are required for comprehensive characterization of mechanosensitive channels:

TechniqueApplicationAdvantagesExamples in MscL Research
ElectrophysiologyFunctional measurement of channel conductance and gating kineticsDirect observation of channel activityUsed to measure channel threshold and conductance states
X-ray CrystallographyHigh-resolution static structuresAtomic-level detailResolved closed state structure of TbMscL
Molecular Dynamics (MD) SimulationsModel dynamic changes during gatingCan simulate tension effectsLDT-MD method showed reproducible transitions to open state
Electron Paramagnetic Resonance (EPR)Distance measurements between specific residuesWorks in membrane environmentPELDOR and ESEEM spectroscopy used to monitor conformational changes
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS)Monitors solvent accessibility changesIdentifies dynamic regionsCharacterized expanded state of TbMscL
Site-Directed MutagenesisTests contribution of specific residuesIdentifies functional domainsG22N and F78N mutations revealed aspects of gating mechanism
Cell Viability AssaysTests channel function in living cellsPhysiological relevanceEvaluates channel's ability to protect against osmotic shock

The combination of these techniques has revealed key insights into the MscL gating mechanism, including the identification of Phe78 as "the primary tension sensor of MscL" and characterization of the lipid-protein interactions involved in mechanosensation.

How have recombinant P. multocida proteins been used in vaccine development research?

Recombinant P. multocida proteins have shown significant promise as subunit vaccine candidates, offering advantages over traditional whole-cell vaccines in terms of safety and specificity. Several strategies have been investigated:

  • Surface protein-based vaccines:

    • Lipoproteins (PlpE, VacJ) and outer membrane proteins (OmpH) have demonstrated strong immunogenic properties

    • A combination of rVacJ, rPlpE, and rOmpH formulated with oil adjuvant provided 100% protection in ducks against challenge with virulent P. multocida

  • Toxin fragment vaccines:

    • A C-terminal fragment of P. multocida toxin (PMT2.3) expressed in E. coli induced protective immunity in mice and swine

    • Vaccination led to "high levels of the anti-PMT antibody with a high neutralizing antibody titer" and "strong protection against a homologous challenge"

  • Epitope-based vaccines:

    • A triple epitope (PlpE1+2+3) fusion protein was developed using bioinformatics to identify immunogenic regions

    • This approach elicited higher IgG levels than commercial vaccines, though protection was equal (69%)

  • Vector-delivered antigens:

    • Attenuated Salmonella Choleraesuis has been used to synthesize and secrete P. multocida PlpE, forming vaccine candidate rSC0016(pS-PlpE)

    • This approach "induced higher antigen-specific mucosal, humoral and mixed Th1/Th2 cellular immune responses" and enhanced survival rate (80%) compared to inactivated vaccine (60%)

These approaches demonstrate the versatility of recombinant protein technology in developing next-generation vaccines against P. multocida infections.

What molecular mechanisms underlie MscL channel gating and how can they be experimentally manipulated?

The gating of MscL is a complex process involving several distinct molecular events that can be manipulated experimentally:

  • Tension sensing mechanism:

    • Membrane tension is primarily sensed at the lipid-protein interface

    • Molecular dynamics simulations identified "Phe78 has a conspicuous interaction with the lipids, suggesting that Phe78 is the primary tension sensor of MscL"

    • The "lipid-moves-first" model proposes that "the number lipid acyl chains occupying TM pockets determined the conformational state of the protein"

  • Gate expansion process:

    • "Increased membrane tension by membrane stretch dragged radially the inner (TM1) and outer (TM2) helices of MscL at Phe78"

    • This force "was transmitted to the pentagon-shaped gate that is formed by the crossing of the neighboring TM1 helices"

    • The resulting "radial sliding of the crossing portions" leads to "gate expansion"

  • Experimental manipulation approaches:

    • Mutagenesis: The L89W mutation in TbMscL "stabilized an expanded and subconducting state" by "hindering the penetration of lipid acyl chains into TM pockets"

    • Chemical modification: "Cysteine mutations with chemical modification" allowed engineering MscL to respond to "various stimuli such as pH and light"

    • Locally distributed tension: The LDT-MD method applies "forces continuously distributed among lipids surrounding the channel" to induce channel opening without disrupting membrane integrity

    • Asymmetric membrane manipulation: Applying different tensions to inner and outer leaflets can model "the effect of single-sided addition of lysolipids"

These approaches have revealed that MscL's gating energy landscape is tension-dependent, with various subconducting states occurring during the transition from closed to fully open conformations.

How do mutations in key residues affect MscL function, and what does this reveal about channel mechanics?

Mutagenesis studies have provided crucial insights into MscL structure-function relationships:

MutationLocationFunctional EffectMechanistic InsightReference
G22NPore-lining TM1Gain of functionLower activation threshold due to destabilized closed state
F78NLipid-facing regionLoss of functionDisrupted tension sensing due to altered lipid interaction
L89W (in TbMscL)TM pocket entranceStabilized subconducting stateHindered lipid acyl chain penetration into TM pockets
Cysteine substitutions with chemical modificationsVarious positionsEngineered gating responsesCreated channels responsive to pH, light, or specific chemicals

These mutations reveal several key principles:

  • The closed state stability is finely balanced and can be disrupted by relatively small changes in pore-lining residues

  • Lipid-protein interactions at specific interfaces are critical for mechanosensation

  • Transmembrane pockets serve as crucial sites for tension sensing and conformational changes

  • Channel gating involves coordinated movements across multiple subunits

PELDOR spectroscopy studies of the L89W mutant demonstrated that "the expanded state was characterized further using hydrogen-deuterium exchange mass spectrometry (HDX-MS) experiments and ESEEM spectroscopy measurements, highlighting structural transitions that occur from modulation by the L89W mutation" . This confirms that mutations can stabilize physiologically relevant intermediate states that provide insights into the normal gating pathway.

What are the current methodological challenges in expressing and purifying functional recombinant MscL for structural studies?

Obtaining sufficient quantities of properly folded, functional MscL presents several challenges:

  • Membrane protein overexpression toxicity:

    • Overexpression can disrupt host cell membrane integrity

    • Solution: Use tightly regulated expression systems and specialized E. coli strains

  • Maintaining native structure during solubilization:

    • Detergents can disrupt crucial lipid-protein interactions

    • Solution: Screen multiple detergents or use nanodiscs/liposomes for reconstitution

  • Functional verification:

    • Difficult to assess channel functionality outside native membrane environment

    • Solution: Develop reconstitution protocols for electrophysiology or liposome-based assays

  • Protein stability during purification:

    • MscL may denature or aggregate during purification steps

    • Solution: Optimize buffer conditions and consider fusion partners to enhance stability

  • Crystallization challenges:

    • Membrane proteins are notoriously difficult to crystallize

    • Solution: Consider alternative structural techniques like cryo-EM or EPR spectroscopy

For spin-labeling studies, researchers have successfully used site-directed spin labeling where "the MTSSL spin label on a introduced cysteine residue, modulated channel function as seen previously for other sulfhydryl modification, but also allowed high-resolution measurements to follow conformational changes in the channel" .

For structural alignment studies comparing MscL from different species, PELDOR measurements have proven valuable, allowing researchers to show "L89W (TbMscL) structurally corresponds to M94 in E. coli" .

How do computational approaches contribute to understanding MscL dynamics and potential applications to P. multocida research?

Computational approaches have become indispensable for understanding MscL dynamics:

  • Molecular dynamics simulations:

    • Novel locally distributed tension MD (LDT-MD) method "allows application of forces continuously distributed among lipids surrounding the channel using a specially constructed collective variable"

    • This approach achieved "reproducible and reversible transitions of MscL to the open state with measured parameters of lateral expansion and conductivity that exactly satisfy experimental values"

    • LDT-MD enables exploration of "the MscL gating process with different pulling velocities and variable tension asymmetry between the inner and outer membrane leaflets"

  • Free energy landscape mapping:

    • LDT-MD combined with well-tempered metadynamics has reconstructed "the tension-dependent free energy landscape for the opening transition in MscL"

    • This reveals energy barriers between states and helps explain the probability of subconductance states

  • Interaction energy calculations:

    • Calculating "interaction energy between membrane lipids and candidate amino acids (AAs) facing the lipids" identified Phe78 as "the primary tension sensor of MscL"

  • Sequence analysis and structure prediction:

    • While not explicitly mentioned in the search results, bioinformatics approaches could be applied to identify potential MscL homologs in P. multocida

    • Sequence-based prediction of immunogenic epitopes has been successful for other P. multocida proteins

  • Applications to P. multocida research:

    • Computational approaches could identify mechanosensitive channels in P. multocida genome

    • Structural models could guide the design of drugs targeting these channels

    • Virtual screening could identify potential modulators of channel function

These computational methods complement experimental approaches and provide insights that would be difficult to obtain through experiments alone.

What strategies can improve the efficacy of recombinant P. multocida protein vaccines and how might mechanosensitive channel research contribute?

Several strategies have demonstrated improved efficacy for recombinant P. multocida vaccines:

  • Antigen combination approaches:

    • A vaccine formulation combining three recombinant proteins (rVacJ+rPlpE+rOmpH) provided 100% protection compared to 33.3%, 83.33%, and 83.33% for individual proteins

    • This suggests synergistic effects between antigens targeting different aspects of bacterial biology

  • Novel delivery systems:

    • Recombinant attenuated Salmonella Choleraesuis vector (rSC0016) delivering P. multocida PlpE showed enhanced survival rate (80%) compared to inactivated vaccine (60%)

    • Live vector delivery can "mimic natural infections by organisms, lead to the induction of mucosal, humoral, and cellular immune responses"

  • Adjuvant optimization:

    • Different adjuvant formulations (water-in-oil vs. oil-coated) significantly affect immune response profiles

    • Induction of balanced Th1/Th2 responses appears beneficial: "the rSC0016(pS-PlpE) recombinant vaccine induced potent, mixed Th1/Th2 cellular immune responses"

  • Epitope-focused design:

    • Bioinformatics-guided design of "potentially immunogenic and protective epitopes" merged to create "the most optimally immunogenic triple epitope PlpE fusion protein"

    • This approach can enhance specific immune responses while eliminating unnecessary or potentially harmful epitopes

  • Potential contributions from mechanosensitive channel research:

    • MscL research methodologies like "the LDT-MD method [that] enables exploration of the MscL gating process with different pulling velocities" could be adapted to study membrane protein dynamics in P. multocida

    • Understanding of protein-lipid interactions from MscL studies could inform membrane protein vaccine design

    • MscL's role in osmotic stress response suggests it might be a target for antibiotic adjuvants or novel therapeutic approaches

    • Insights into bacterial adaptation mechanisms could identify new vaccine targets

The integration of these approaches with advances in structural biology and immunology presents promising avenues for next-generation vaccine development against P. multocida infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.