Recombinant Pasteurella multocida Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pasteurella multocida Lipid A Export ATP-Binding/Permease Protein MsbA

The recombinant Pasteurella multocida Lipid A export ATP-binding/permease protein MsbA is a crucial component in the lipid A transport pathway of Gram-negative bacteria. This protein plays a vital role in transporting lipid A and lipopolysaccharide from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane, which is essential for the integrity and function of the bacterial outer membrane .

Characteristics of MsbA

  • Function: MsbA is an ATP-binding cassette (ABC) transporter that facilitates the transport of lipid A, a key component of lipopolysaccharides, across the inner membrane .

  • Structure: The structure of MsbA from Salmonella typhimurium has been resolved at 2.8-Å resolution, showing a large amplitude opening in the transmembrane portal necessary for lipid A transport .

  • Importance: MsbA is essential for bacterial survival as it ensures the proper assembly of lipopolysaccharides in the outer membrane, which protects bacteria from environmental stress and host immune responses .

Role of MsbA in Bacterial Pathogenesis

MsbA's role in bacterial pathogenesis is multifaceted. It contributes to the structural integrity of the bacterial outer membrane by ensuring the correct localization of lipopolysaccharides, which are critical for evading host immune responses. In pathogens like Pasteurella multocida, MsbA helps maintain the integrity of the outer membrane, which is essential for virulence and survival within host environments .

MsbA in Pasteurella multocida

  • Disease Association: Pasteurella multocida causes a range of diseases in mammals and birds, including fowl cholera and bovine hemorrhagic septicemia .

  • MsbA Function: The MsbA protein in Pasteurella multocida is involved in the transport of lipid A, which is crucial for the assembly of lipopolysaccharides, a key virulence factor .

Functional Importance

  • Essential for Bacterial Survival: MsbA is essential for maintaining the integrity of the bacterial outer membrane, which is critical for bacterial survival and pathogenesis .

  • Implications for Vaccine Development: Understanding MsbA's role could provide insights into developing novel vaccines targeting bacterial membrane components .

Applications and Future Directions

The recombinant Pasteurella multocida MsbA protein has potential applications in research and vaccine development. It can be used to study the lipid A transport pathway and to develop novel therapeutic strategies against Gram-negative bacterial infections.

Potential Applications

  1. Vaccine Development: MsbA could serve as a target for developing vaccines that disrupt bacterial membrane assembly.

  2. Antibiotic Development: Inhibitors targeting MsbA could be developed as novel antibiotics.

  3. Basic Research: Recombinant MsbA can be used to study the mechanisms of lipid A transport and its role in bacterial pathogenesis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
msbA; PM0861; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
msbA
Target Protein Sequence
MQDKDLSTVQTFKRLWPIISPFKLGLVVSGIALVINALADAGLISLLKPLLDEGFGKADV SFLRTMSYVVVLVIFLRGISNFISSYCLSWVSGKVVMIMRRRIFKHLMFMPVPFFDQNSS GRLLSRITYDSELVANSSSGALITIVREGAYIISLLAVMLYTSWQLSIVLFLIGPIIAVL IRFVSKRFRELSKNMQNSMGELTSTAEQMLKGHKVVLSFGGQIVEEERFNHVSNDMRRKG MKMAVADAISNPVVQIIASFALAAVLYLATVPTIMDQNLTAGSFTVVFSSMLAMMRPLKS LTNVNAQFQKGMAACQTLFALLDLETEKDLGTHKGENVQGYLSFKNVTFTYQSRDEPALR NLSFDVEKGKTVALVGRSGSGKSTIANLVTRFYDVDQGEITLDGINIQDYRLSSLRKNCA VVSQQVHLFNDTIANNIAYAAKDKYSREEIIKAAKDAYAMEFIEKLEHGLDTVIGENGVN LSGGQRQRLAIARALLRNSPVLILDEATSALDTESERSIQLALEKLQKERTVIVIAHRLS TIENADEILVIEHGEIKERGSHSELLALNGAYKQLHHIQVNH
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. Its function is to translocate the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) provides the energy for this process.
Database Links

KEGG: pmu:PM0861

STRING: 272843.PM0861

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida MsbA and what is its significance in bacterial physiology?

MsbA is an essential membrane protein in P. multocida that functions as a lipid A transporter, facilitating the movement of lipopolysaccharide components across the bacterial inner membrane. This ABC transporter family protein is critical for outer membrane biogenesis and bacterial survival. The protein contains 582 amino acids with both ATP-binding cassettes and transmembrane domains that work together to enable lipid flipping across the membrane . As P. multocida causes significant diseases in mammals and birds (including fowl cholera, atrophic rhinitis, and hemorrhagic septicemia), understanding the function of its essential membrane proteins provides insights into bacterial physiology and potential therapeutic targets .

How does the amino acid sequence of P. multocida MsbA compare with homologous proteins in other bacterial species?

The P. multocida MsbA protein consists of 582 amino acids with a sequence that includes multiple transmembrane domains and nucleotide-binding domains characteristic of ABC transporters. Comparative analysis shows that while the core functional domains remain conserved across bacterial species, there are species-specific variations in certain regions. For example, the P. multocida MsbA (Q9CMG7) shares structural similarities with the Blochmannia floridanus MsbA (Q7VR44), though with distinct sequence variations in key regions . The amino acid sequence includes characteristic motifs such as the Walker A and Walker B motifs in the ATP-binding domain and transmembrane helices that form the substrate pathway.

What expression systems yield optimal results for recombinant P. multocida MsbA production?

E. coli expression systems, particularly E. coli BL21(DE3), have been successfully employed for the recombinant production of P. multocida proteins . For MsbA specifically, plasmid vectors such as pET28a are suitable for protein expression with affinity tags (typically His-tag) to facilitate purification . The protein can be expressed as a full-length construct (1-582 amino acids) with the N-terminal His-tag to maintain functional integrity . Researchers should optimize expression conditions including temperature (typically 16-25°C post-induction), IPTG concentration (0.1-0.5 mM), and duration (4-16 hours) to maximize protein yield while minimizing inclusion body formation.

What purification strategies are most effective for obtaining active recombinant P. multocida MsbA?

Purification of recombinant P. multocida MsbA typically employs a multi-step approach:

  • Initial capture: Ni-NTA affinity chromatography utilizing the His-tag

  • Membrane extraction: Detergent solubilization (typically with n-dodecyl-β-D-maltoside or similar mild detergents)

  • Secondary purification: Size exclusion chromatography to remove aggregates

  • Optional ion exchange chromatography for higher purity

The purified protein should be maintained in a stabilizing buffer containing detergent micelles or reconstituted into lipid nanodiscs or proteoliposomes to preserve functional activity. Researchers should avoid repeated freeze-thaw cycles as this can significantly reduce protein activity .

How can researchers assess the ATPase activity of purified recombinant P. multocida MsbA?

ATPase activity of purified MsbA can be determined using multiple complementary approaches:

MethodPrincipleAdvantagesLimitations
Malachite Green AssayColorimetric detection of released phosphateHigh sensitivity, simple setupEndpoint measurement only
Coupled-enzyme assayADP production linked to NADH oxidationReal-time continuous monitoringPotential interference from coupling enzymes
Radioactive ATP assayMeasurement of 32P-ATP hydrolysisDirect quantificationRequires radioactive handling facilities
ATP-luminescence assayMeasures remaining ATP via luciferaseHigh sensitivityIndirect measurement

For optimal results, researchers should perform assays at physiologically relevant temperatures (37°C) and validate results across multiple methods to ensure reliability.

What methods can be used to study the lipid A transport function of P. multocida MsbA?

Lipid A transport can be assessed through:

  • Reconstitution of purified MsbA into proteoliposomes with fluorescently labeled lipid A analogs

  • Inside-out membrane vesicle preparation from MsbA-expressing cells

  • Measurement of lipid translocation using NBD-labeled lipid analogs and dithionite quenching assays

  • Fluorescence resonance energy transfer (FRET) between labeled lipids and protein domains

These methodologies provide insights into the transport kinetics, substrate specificity, and mechanistic details of MsbA-mediated lipid translocation.

What structural features distinguish P. multocida MsbA from other bacterial lipid flippases?

The P. multocida MsbA contains species-specific residues in the substrate-binding pocket that may affect lipid A binding specificity. The protein's full amino acid sequence reveals distinctive features in the transmembrane regions and connecting loops that could influence substrate recognition and transport efficiency . These distinctive structural elements may contribute to the specific interactions between MsbA and the P. multocida cell envelope components, potentially offering targets for species-specific inhibition.

What is known about MsbA interactions with host immune recognition pathways?

MsbA itself is not directly exposed to host immune systems, but the LPS it transports is a potent activator of innate immunity. Research on P. multocida has shown that bacterial outer membrane components interact with Toll-like receptors (TLRs), particularly TLR4 and TLR2 . These interactions trigger pro-inflammatory cytokine production (IL-1β, TNF-α, IL-6, and IL-12p40) through activation of NF-κB, ERK1/2, and p38 signaling pathways . While MsbA is not directly involved in these interactions, its role in LPS transport makes it indirectly significant in immune recognition and inflammatory responses during P. multocida infection.

What controls should be included when studying recombinant P. multocida MsbA in functional assays?

Rigorous experimental design for MsbA functional studies should include:

  • Negative controls:

    • Heat-inactivated MsbA (protein boiled to denature structure)

    • ATPase-deficient mutant (Walker A/B motif mutations)

    • Empty vector-transformed cells processed identically

  • Positive controls:

    • Known functional ABC transporter from related species

    • Commercial ATPase standards with defined activity units

  • Validation controls:

    • Multiple substrate concentrations to establish kinetic parameters

    • Inhibitor controls (vanadate, EDTA) to confirm specific ATPase activity

    • Detergent-solubilized vs. liposome-reconstituted protein comparisons

These controls help distinguish specific MsbA activity from background signals and provide benchmarks for interpreting experimental results.

How can researchers develop genetic systems to study MsbA function in P. multocida?

Genetic manipulation of MsbA in P. multocida requires careful consideration given its essential nature. Recommended approaches include:

  • Conditional expression systems using inducible promoters to control MsbA levels

  • Complementation strategies with wild-type and mutant alleles

  • Domain swapping with homologous proteins to identify functional regions

  • Site-directed mutagenesis targeting conserved motifs

Research on other P. multocida virulence factors has successfully employed gene deletion and complementation strategies, which could be adapted for MsbA studies when combined with conditional expression systems .

How might MsbA be targeted for antimicrobial development against P. multocida infections?

MsbA represents a promising antimicrobial target due to its essential role in bacterial membrane biogenesis. Potential targeting strategies include:

  • ATPase inhibitors that prevent energy coupling for lipid transport

  • Compounds that interfere with lipid A binding in the transmembrane domain

  • Molecules that lock the protein in an inactive conformational state

  • Peptides that disrupt critical protein-protein interactions in the transporter complex

Researcher should consider that P. multocida causes significant diseases in livestock and can be transmitted to humans through animal bites, making it an important pathogen for targeted antimicrobial development .

What approaches can be used to study P. multocida MsbA in native membrane environments?

To study MsbA in native-like conditions, researchers can employ:

  • Nanodiscs technology: Reconstitution of purified MsbA into lipid nanodiscs with defined composition

  • Native mass spectrometry to identify interaction partners in membrane preparations

  • In situ crosslinking to capture transient interactions in living bacterial cells

  • Fluorescence microscopy with minimally disruptive protein tags to track localization

These approaches help overcome limitations of detergent-solubilized systems and provide insights into MsbA function within its native lipid environment.

How does P. multocida MsbA compare functionally with homologs from other Pasteurellaceae family members?

P. multocida MsbA shares structural similarity with homologs from related species in the Pasteurellaceae family, but with potential functional adaptations related to the specific lipid A structures found in P. multocida. The amino acid sequence of P. multocida MsbA (582 amino acids) contains regions that likely contribute to species-specific substrate recognition . Comparative genomic analyses could reveal selection pressures on different domains of the protein across the Pasteurellaceae family, potentially identifying regions involved in adaptation to different host environments.

What can structural modeling reveal about the conformational dynamics of P. multocida MsbA during the transport cycle?

Structural modeling based on the P. multocida MsbA sequence can provide insights into:

  • Conformational transitions between inward-facing, outward-facing, and occluded states

  • Coupling mechanism between ATP hydrolysis and substrate translocation

  • Binding pocket adaptations for P. multocida-specific lipid A structures

  • Potential allosteric sites that influence transport activity

These models can guide experimental design for mutagenesis studies and help interpret functional data in a structural context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.