Recombinant Pasteurella multocida Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Pasteurella multocida is a bacterium known to cause various diseases in animals and, less frequently, in humans . Infections typically result from animal bites, scratches, or contact with nasopharyngeal secretions . Within the bacterium, the monofunctional peptidoglycan glycosyltransferase (MtgA) plays a crucial role in cell wall biosynthesis .

Function of MtgA

MtgA is an enzyme that catalyzes glycan chain elongation during peptidoglycan synthesis, which is essential for bacterial cell wall formation . Peptidoglycan glycosyltransferases, including MtgA, couple Lipid II subunits to synthesize peptidoglycan chains .

The reaction catalyzed by peptidoglycan glycosyltransferase is:
$$
\begin{aligned}
& \text{[GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-gamma-D-Glu-L-Lys-D-Ala-D-Ala)]n-diphosphoundecaprenol} \
& + \text{GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-gamma-D-Glu-L-Lys-D-Ala-D-Ala)-diphosphoundecaprenol} \
& \rightleftharpoons \
& \text{[GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-gamma-D-Glu-L-Lys-D-Ala-D-Ala)]n+1-diphosphoundecaprenol} \
& + \text{undecaprenyl diphosphate}
\end{aligned}
$$
where:

  • GlcNAc is N-Acetylglucosamine

  • Mur2Ac is N-Acetylmuramic acid

MtgA in Escherichia coli

In Escherichia coli, MtgA has been shown to localize at the division site in cells deficient in PBP1b (Penicillin-Binding Protein 1b) and producing a thermosensitive PBP1a . MtgA interacts with divisome components such as PBP3, FtsW, and FtsN, suggesting its involvement in peptidoglycan assembly during the cell cycle in collaboration with other proteins .

Role in Pathogenicity

Studies indicate that in Pasteurella multocida and Brucella abortus, Mtg may play a role in bacterium-host interactions . When P. multocida is depleted of class A PBP1c (a homologue of E. coli PBP1c), it grows similarly to the wild type in broth medium but shows significant attenuation of pathogenicity in mice . Similarly, B. abortus depleted of Mtg also shows reduced pathogenicity .

Genetic and Phylogenetic Characteristics of Pasteurella multocida

Pasteurella multocida strains exhibit diverse genetic characteristics, influencing their pathogenicity in different hosts . Common capsule: LPS genotypes for avian P. multocida are A: L1 and A: L3 . Serotypes A:1, A:3, or A:4 are frequently associated with fowl cholera . In bovine species, serotype B: 2 strains are linked to haemorrhagic septicaemia, while A: 3 strains are associated with respiratory diseases .

HostCommon Capsule: LPS Genotypes
AvianA: L1, A: L3
BovineB: L2, A: L3
PorcineD: L6, A: L3, A: L6
RabbitA: L3

ProQ and its Role in P. multocida

The RNA-binding protein ProQ in P. multocida regulates the expression of small RNAs (sRNAs) and transfer RNAs (tRNAs) . ProQ stabilizes the prc transcript by binding to its 5' UTR, influencing its expression .

Outer Membrane Vesicles (OMVs) of P. multocida

Outer membrane vesicles (OMVs) from P. multocida can directly interact with macrophages and modulate their immune function . These OMVs, with an average diameter of approximately 147.5 nm, exhibit a high abundance of membrane-associated proteins that can trigger the host’s immune response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; PM0324; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
mtgA
Target Protein Sequence
MSKLKKTKHPFPCFSIWQQFKRKLYRTFALFLVLFLSSVVLFRFVPVPFSAYMLQQKIGY LFEGNLSSTIHYQWVPLEQISQSMQLAVIASEDQRFATHYGFDWDAIQSALQHNQRGKRI RGGSTISQQTAKNLYLWHGQSWLRKAIEMPTTLVLETLWSKKRILEVYLNIAEFGPNIFG VEAASQHYFRKPAKQLSNAEAALLAAVLPNPIIFKVNKPSAYVKKRQQHIQRQMGLLGKQ HLSQLD
Uniprot No.

Target Background

Function

Function: Recombinant Pasteurella multocida Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links

KEGG: pmu:PM0324

STRING: 272843.PM0324

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What expression systems and purification methods are recommended for obtaining functional recombinant P. multocida mtgA?

Expression Systems:
E. coli is the preferred expression system for recombinant P. multocida mtgA production . The gene can be cloned into vectors with suitable promoters (T7, tac) and fusion tags to enhance expression and facilitate purification.

Purification Protocol:

  • Express full-length mtgA (1-246 aa) with an N-terminal His-tag in E. coli

  • Lyse cells in Tris-based buffer with protease inhibitors

  • Purify using nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography

  • Elute with imidazole gradient

  • Dialyze against storage buffer (Tris-based buffer with 50% glycerol)

  • Verify purity by SDS-PAGE (>90% purity is typically achievable)

Storage Recommendations:

  • Store as aliquots at -20°C for regular use or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

How can researchers verify the enzymatic activity of purified recombinant mtgA?

Several complementary approaches can be used to verify mtgA activity:

FRET-Based Real-Time Assays:

  • Use fluorescently labeled lipid II substrates (Atto550 as donor, Atto647n as acceptor)

  • Monitor activity in phospholipid vesicles or planar lipid bilayers

  • Allows simultaneous detection of both glycosyltransferase activity and product formation

SDS-PAGE Analysis:

  • Separate lipid II and glycan strands products by SDS-PAGE

  • Detect radiolabeled substrates by autoradiography

  • Quantify bands by densitometric analysis

HPLC Analysis of Reaction Products:

  • React mtgA with radiolabeled lipid II

  • Stop reaction by boiling at mild acidic pH

  • Hydrolyze with muramidase (cellosyl or mutanolysin)

  • Reduce with sodium borohydride

  • Analyze by HPLC with radioactivity flow-through detection

This approach allows calculation of:

  • Average glycan strand length

  • Extent of peptide cross-linkage

  • Formation of higher oligomers

How does P. multocida mtgA compare structurally and functionally to other bacterial transglycosylases?

While the crystal structure of P. multocida mtgA has not been specifically reported in the search results, comparative analysis with other bacterial transglycosylases reveals important structural and functional insights:

Structural Comparison:
Based on studies of related enzymes like S. aureus MtgA, these enzymes typically contain:

  • A transmembrane (TM) helix that influences activity and glycan chain length

  • A catalytic domain with conserved motifs involved in substrate binding and catalysis

Key Catalytic Residues:
In S. aureus MtgA, the catalytic mechanism involves:

  • E100 acting as a general base for the 4-OH of GlcNAc to facilitate transglycosylation

  • K140 and R148 stabilizing the pyrophosphate leaving group of lipid II

  • G130, Q137, K140, N141, R148, and N224 forming the donor binding site

  • S98, E102, R103, R117, S132, R241, and K248 forming the acceptor binding site

Corresponding residues in P. multocida mtgA likely perform similar functions, though experimental confirmation is needed.

Functional Comparison:

EnzymeSpeciesSize (kDa)Key Features
mtgAP. multocida~28Monofunctional GTase
MtgAS. aureus~26Monofunctional GTase, crystal structure available with substrate analogs
PBP1BE. coli~84Bifunctional GTase/TPase, dimerizes, produces cross-linked material from reaction onset
PBP1AE. coli~92Bifunctional GTase/TPase, requires pre-oligomerized PG as acceptor for TPase reactions

What experimental approaches can be used to study the role of mtgA in bacterial cell morphology and wall biosynthesis?

Gene Deletion Studies:
Create mtgA knockout mutants using:

  • Homologous recombination

  • CRISPR-Cas9 gene editing

  • Transposon mutagenesis

A study of E. coli JW3175 (ΔmtgA) demonstrated:

  • Under non-polymer-producing conditions: Similar cell size to parent strain

  • Under polymer-producing conditions: Cell diameter increased 1.4-fold

  • Cells became "fat" rather than "tall"

RNA-Seq Analysis:
Compare transcriptome profiles between wild-type and mtgA mutants to identify regulatory networks affected by mtgA deletion.

For example, in P. multocida studies:

  • RNA-seq revealed effects on capsular polysaccharide transport

  • LPS synthesis genes were significantly down-regulated

  • Iron-related genes showed differential expression

Microscopy Techniques:

  • Phase contrast for basic morphology

  • Fluorescence microscopy with labeled cell wall precursors

  • Electron microscopy for detailed cell wall architecture

Polymer Production Analysis:
The deletion of mtgA in E. coli affected polymer production as shown in this data:

GenotypePlasmidCell dry weight (g/l)True cell weight (g/l)Polymer production (g/l)
Wild typepTV118N pct phaC1 Ps(ST/QK) AB9.2 ± 0.24.1 ± 0.35.2 ± 0.1
Δ mtgApTV118N pct phaC1 Ps(ST/QK) AB11.6 ± 1.04.6 ± 0.97.0 ± 0.4
Δ mtgA complementedpTV118N pct phaC1 Ps(ST/QK) AB + pCA24N-mtgA8.0 ± 0.73.2 ± 0.34.9 ± 0.3

This indicates mtgA deletion enhanced polymer production by approximately 35% .

What is known about the catalytic mechanism of peptidoglycan transglycosylases and how can it be experimentally investigated?

Based on studies of S. aureus MtgA, the proposed catalytic mechanism involves:

Reaction Steps:

  • Lipid II binds at the acceptor site (S1) and is stabilized by S98, E102, R103, R117, S132, R241, and K248

  • The 4-OH of GlcNAc is deprotonated by E100, which is stabilized by R241

  • Nucleophilic attack on the C1 carbon of the donor lipid II (or growing chain) at site S2

  • K140 and R148 facilitate the departure of the pyrophosphate leaving group

  • After forming the β1–4-linked glycan chain, the product is shuffled to the donor site

  • A new lipid II binds at the acceptor site for another round of transglycosylation

Experimental Investigation Methods:

  • Site-Directed Mutagenesis:

    • Create single mutations of key catalytic residues (E100, K140, R148)

    • Analyze effects on enzyme activity using FRET-based assays

  • Crystal Structures with Inhibitors:

    • Co-crystallize with moenomycin (occupies donor site)

    • Co-crystallize with lipid II analogs

    • Determine structures by X-ray crystallography

  • Processivity Studies:

    • Use SDS-PAGE to separate glycan strand products of different lengths

    • Analyze the distribution of product lengths under different conditions

  • Substrate Specificity Analysis:

    • Test modified lipid II substrates with variations in:

      • Peptide stem composition

      • Lipid chain length

      • Sugar modifications

How does mtgA deletion affect bacterial cell physiology and what are the potential applications of this knowledge?

The deletion of mtgA has profound effects on bacterial physiology:

Cell Morphology Effects:

  • E. coli cells with mtgA deletion became enlarged ("fat cells") under polymer-producing conditions

  • Cell diameter increased without changing polar axis length

Polymer Production:

  • ΔmtgA strains produced 35% more P(LA-co-3HB) polymer (7.0 g/l) than wild-type (5.2 g/l)

  • Complementation with mtgA gene restored normal polymer production (4.9 g/l)

  • Glucose consumption was more rapid in ΔmtgA strains

  • Polymer yield from glucose increased from 3.1 g/g to 3.6 g/g

Metabolic Implications:

  • The altered cell wall architecture likely affects:

    • Membrane permeability

    • Nutrient uptake efficiency

    • Intracellular space for polymer accumulation

Applications:

  • Biopolymer Production:

    • Engineering mtgA-deficient strains for enhanced polymer synthesis

    • Potential use in industrial biopolymer production

  • Antibiotic Development:

    • Understanding peptidoglycan synthesis mechanisms

    • Design of novel antibiotics targeting transglycosylases

  • Vaccine Development:

    • mtgA-deficient strains as potential live attenuated vaccines

    • Structural understanding for subunit vaccine design

What roles do transglycosylases play in bacterial pathogenesis and antibiotic resistance?

Pathogenesis Connections:
Peptidoglycan synthesis enzymes impact multiple aspects of bacterial pathogenesis:

  • Cell Wall Integrity:

    • Essential for survival under host immune pressures

    • Proper cell wall architecture needed for virulence

  • Immune System Interaction:

    • Peptidoglycan fragments recognized by host pattern recognition receptors

    • Triggering of inflammatory responses

  • Virulence Factor Expression:
    RNA-seq analysis of P. multocida gene deletions showed effects on:

    • Capsular polysaccharide transport genes

    • LPS synthesis-related genes (lpxD, VipA, galE, capD)

    • Iron utilization genes

Antibiotic Resistance Implications:

Transpeptidases (TPases) have been the primary target for β-lactam antibiotics, but transglycosylases (GTases) represent an alternative target that could help overcome resistance:

  • Transpeptidase-targeting antibiotics (like β-lactams) face widespread resistance

  • Transglycosylases have been considered excellent targets, but few effective inhibitors exist

  • Moenomycin is the only natural product inhibitor of transglycosylases in clinical use (as animal feed additive)

  • Understanding the structure and mechanism of mtgA and related enzymes can guide rational drug design

Research suggests that targeting both GTase and TPase activities simultaneously could be an effective strategy against resistant bacteria .

What experimental considerations are crucial when designing assays to measure transglycosylase activity in membrane environments?

Challenges in Transglycosylase Assay Design:

  • Membrane Environment:

    • Detergents and DMSO affect activity and interactions of membrane enzymes like transglycosylases

    • Free diffusion in detergent differs significantly from the confined two-dimensional membrane environment

  • Substrate Complexity:

    • Natural substrate (lipid II) is complex and difficult to obtain in large quantities

    • Lipid II analogs may not fully recapitulate natural substrate behavior

Methodological Solutions:

  • Membrane Reconstitution:

    • Reconstitute enzymes in liposomes or supported lipid bilayers

    • Provides more physiologically relevant environment than detergent solutions

  • Real-time FRET-based Assays:

    • Use lipid II labeled with FRET pairs (Atto550 as donor, Atto647n as acceptor)

    • Allows monitoring of both glycosyltransferase and transpeptidase activities simultaneously

    • Sensitive detection without interference with enzymatic activity

  • Product Analysis Methods:

    • Use muramidases (cellosyl or mutanolysin) to release muropeptides

    • HPLC analysis of reaction products with radioactivity detection

    • Analysis of glycan strand length and cross-linking

  • Considerations for Different Bacterial Species:

    • Substrate modifications may be species-specific

    • Some enzymes from Gram-positive species require amidated lipid II substrate

Example Protocol for FRET-based Assay:

  • Prepare lysine-type lipid II with Atto550 (donor) and Atto647n (acceptor)

  • Reconstitute PG synthase in liposomes or supported lipid bilayers

  • Monitor FRET signal changes in real-time as lipid II is incorporated into growing glycan chains

  • Quantify reaction rates under various conditions (temperature, pH, ion concentration)

How can structural information about mtgA be leveraged for antibacterial drug development?

The transglycosylase domain represents an attractive but underexploited target for antibacterial development:

Structural Considerations for Drug Design:

  • Active Site Architecture:
    Based on S. aureus MtgA crystal structures:

    • The donor site (S2) includes G130, Q137, K140, N141, R148, and N224

    • The acceptor site (S1) includes S98, E102, R103, R117, S132, R241, and K248

    • E100 serves as catalytic base

    • K140 and R148 stabilize the pyrophosphate leaving group

    These conserved residues form potential targets for inhibitor design.

  • Targeting Lipid II Binding:

    • Design molecules that mimic lipid II structure but cannot be processed

    • Target both donor and acceptor sites for enhanced inhibition

  • Moenomycin as Template:

    • Currently the only known natural product inhibitor of transglycosylases

    • Binds to donor site of transglycosylases

    • Poor pharmacokinetics limits human use

    • Can serve as starting point for rational drug design

Drug Discovery Approaches:

  • Fragment-Based Drug Design:

    • Screen small molecular fragments that bind to specific sites

    • Link or grow fragments to create high-affinity inhibitors

  • Structure-Based Virtual Screening:

    • Use crystal structures to virtually screen compound libraries

    • Prioritize compounds for biochemical testing

  • High-Throughput Screening:

    • Develop FRET-based assays compatible with HTS format

    • Screen natural product or synthetic compound libraries

  • Enzymatic Macrolactamization:

    • Use microbial transglutaminase (mTG) for cyclization of peptide libraries

    • Screen for inhibitors of transglycosylase activity

Success Criteria for Inhibitors:

  • Conservation of target residues across bacterial species

  • Activity against drug-resistant strains

  • Limited toxicity to mammalian cells

  • Suitable pharmacokinetic properties

The conservation of lipid II-contacting residues in wild-type and drug-resistant bacteria makes this an especially promising approach for developing broad-spectrum antibiotics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.