Recombinant Pasteurella multocida Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; PM1332; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGIAVPVNQLVY SFILKDSALVQGIDLSFLNFITFIGVIAALVQILEMVLDKYFPALYNALGIFLPLITVNC AIFGGVSFMVQRDYTFVESVVYGIGAGTGWMLAIVALAGITEKMKYADVPAGLRGLGITF ITVGLMALGFMSFSGIQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: pmu:PM1332

STRING: 272843.PM1332

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Recombinant Pasteurella multocida Na(+)-translocating NADH-quinone reductase subunit E (nqrE) in bacterial metabolism?

The Na(+)-translocating NADH-quinone reductase subunit E (nqrE) is a critical component of the Na+-NQR complex that catalyzes the reduction of ubiquinone-1 to ubiquinol through two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. This respiratory chain complex serves as a primary sodium pump in many marine and pathogenic bacteria, including Pasteurella multocida.

Methodologically, the function of nqrE can be studied by:

  • Measuring dNADH oxidase and dNADH:menadione oxidoreductase activities in membrane vesicles

  • Assessing Na+-stimulated, HQNO-inhibited dNADH oxidase activity

  • Conducting gene knockout studies followed by complementation experiments

Research has shown that nqrE forms part of the (Cys)4[Fe] center between subunits NqrD and NqrE, which is crucial for electron transfer. Expression studies in E. coli have demonstrated that production of functional Na+-NQR capable of quinone reduction critically depends on the presence of both ApbE and NqrM proteins .

What are the optimal methods for expressing and purifying functional recombinant nqrE protein?

Expressing and purifying functional recombinant nqrE requires careful consideration of several methodological factors:

Expression System Selection

The most effective expression system for nqrE is the in vitro E. coli expression system, which has been successfully used to produce full-length protein with an N-terminal 10xHis-tag .

Expression Protocol

  • Clone the nqrE gene (coding for aa 1-198) into an appropriate expression vector (e.g., pET-based)

  • Transform into E. coli expression host cells

  • Induce protein expression under optimized conditions

  • Extract and purify using affinity chromatography

Purification Strategy

The recommended purification approach includes:

  • Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

  • Storage in Tris-based buffer with 50% glycerol at pH 8.0

  • Aliquoting and storing at -20°C/-80°C to avoid repeated freeze-thaw cycles

Recent studies have shown that expression of V. harveyi Na+-NQR in E. coli ANN091 (nuoI::Kmr) cells provides a useful model system for studying nqrE function within the complete NQR complex .

What are the structural characteristics of nqrE essential for its function?

The structural features of nqrE crucial for its function include:

Transmembrane Topology

nqrE contains multiple transmembrane regions that are critical for Na+ translocation, with hydrophobic amino acid sequences forming membrane-spanning domains .

Iron-Sulfur Center

nqrE participates in forming the (Cys)4[Fe] center between subunits NqrD and nqrE, which is essential for electron transfer within the complex .

Detailed structural analysis using X-ray crystallography or cryo-EM would further elucidate the precise arrangement of transmembrane helices and the coordination of the iron-sulfur center, which are critical for understanding the mechanism of coupled electron transfer and Na+ translocation.

Experimental Design Considerations for nqrE Research

Studying nqrE functionality requires carefully designed experiments that account for its role within the larger Na+-NQR complex. Recommended experimental designs include:

Quasi-Experimental Approaches

When studying nqrE in the context of bacterial physiology, researchers should consider:

Design TypeKey ElementsAdvantagesDisadvantages
Pre-Post with Non-equivalent controlComparison of wildtype versus nqrE mutant strainsSimplicity of implementationTemporal biases may result in regression to the mean
Interrupted Time SeriesMultiple observations before and after nqrE manipulationControls for many threats to internal validityRequires more data points and longer observation periods
Stepped Wedge DesignRandomized time of crossover in nqrE expressionProvides robust causal inferenceMore complex to implement

Expression System for Functional Studies

For in vitro studies, co-expression of all Na+-NQR components is critical:

  • Use pBAD expression vector containing genes for Na+-NQR, ApbE, and nqrM1

  • Express in E. coli ANN091 (nuoI::Kmr) cells deficient in H+-translocating NADH:quinone oxidoreductase (NDH-1)

  • Measure dNADH oxidase and dNADH:menadione oxidoreductase activities to assess functionality

This approach allows for isolation of nqrE function within the complete NQR complex by enabling the study of Na+-stimulated, HQNO-inhibited dNADH oxidase activity, which is observed only when the whole set of functional genes is expressed .

How can researchers analyze and resolve contradictory results in nqrE research?

When faced with contradictory results in nqrE research, researchers should apply a structured contradiction analysis approach:

Methodological Framework for Resolving Contradictions

  • Dialectical Analysis: Approach contradictions as potential sources of insight rather than errors. Frame contradictions as tensions between different aspects of nqrE function that may reveal underlying mechanisms .

  • Interpretive Listening: Go beyond positivist approaches that rely solely on triangulation to find "truth." Instead, examine the research context carefully to understand the conditions that produce apparent contradictions .

  • Systematic Resolution Protocol:

    • Document all contradictory findings in detail

    • Identify potential sources of variation (experimental conditions, strain differences, expression systems)

    • Analyze whether contradictions represent different aspects of the same phenomenon

    • Design experiments specifically to test competing hypotheses

Practical Approaches for nqrE Research

When contradictory results emerge regarding nqrE function:

  • Experimental System Variations: Compare expression systems (e.g., E. coli vs. native P. multocida) to determine if host factors influence nqrE behavior

  • Complementation Studies: Conduct complementation experiments in nqrE knockout strains to verify that observed phenotypes are directly attributable to nqrE function

  • Multi-Method Validation: Employ multiple methods to assess the same parameter (e.g., protein-protein interactions through both co-immunoprecipitation and yeast two-hybrid analysis)

This framework enables researchers to transform contradictions from obstacles into opportunities for deeper understanding of nqrE function.

How does nqrE function compare across different bacterial species containing Na+-NQR complexes?

The Na+-NQR complex containing nqrE is present in various bacterial species, with important functional similarities and differences:

Comparative Analysis of nqrE Across Species

Bacterial SpeciesnqrE CharacteristicsFunctional SignificanceReference
Pasteurella multocida198 amino acids, forms (Cys)4[Fe] centerEssential for respiratory chain
Vibrio harveyiRequires NqrM for maturationCritical for full Na+-NQR activity
Vibrio choleraeExpression of P. multocida Na+-NQR components restores activityFunctional conservation across species
Klebsiella pneumoniaeContains nqrM genes necessary for maturationShows similar electron transport mechanism

Methodological Approaches for Comparative Studies:

  • Sequence Alignment Analysis: Determine conserved regions and species-specific variations in nqrE

  • Heterologous Expression: Express nqrE from different species in a common host to assess functional conservation

  • Complementation Studies: Test if nqrE from one species can functionally replace nqrE in another

Research has demonstrated that coexpression of Vibrio harveyi nqr genes with apbE and nqrM in E. coli results in a fully functional Na+-NQR complex, suggesting conservation of fundamental mechanisms across species . Additionally, expression of V. harveyi Na+-NQR components in V. cholerae O395N1 ΔnqrABCDEF cells resulted in complete recovery of Na+-NQR activity, confirming functional interchangeability across species .

Recommended Methodologies for Protein-Protein Interaction Studies

Investigating interactions between nqrE and other NQR complex subunits requires specialized techniques that preserve native protein conformations and capture both stable and transient interactions:

In Vitro Methods

  • Co-immunoprecipitation with Tagged Proteins:

    • Express nqrE with an N-terminal 10xHis-tag

    • Use anti-His antibodies to pull down nqrE and associated proteins

    • Analyze co-precipitated proteins by western blot or mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified nqrE on a sensor chip

    • Flow other purified NQR subunits over the surface

    • Measure real-time binding kinetics and affinities

  • Cross-linking Mass Spectrometry:

    • Apply chemical cross-linkers to stabilize protein complexes

    • Digest cross-linked complexes and analyze by mass spectrometry

    • Identify interaction sites between nqrE and other subunits

In Vivo Methods

  • Bacterial Two-Hybrid Systems:

    • Create fusion proteins of nqrE and potential interacting partners

    • Measure reporter gene expression as an indicator of interaction

    • Particularly useful for membrane proteins like nqrE

  • Co-expression Studies:

    • Express nqrE with other NQR subunits in E. coli

    • Assess functional activity (e.g., dNADH oxidase activity)

    • Compare activity with and without specific subunits to determine essential interactions

Research has shown that formation of the (Cys)4[Fe] center between subunits NqrD and nqrE is critical for electron transfer, suggesting these two subunits have particularly important interactions that should be prioritized for study .

Comprehensive Mutation Analysis Framework

Studying the effects of nqrE mutations requires a multi-faceted approach that addresses both structure-function relationships and physiological consequences:

Site-directed Mutagenesis Strategy

  • Target Key Functional Domains:

    • Transmembrane regions involved in Na+ translocation

    • Cysteine residues involved in forming the (Cys)4[Fe] center

    • Conserved residues identified through sequence alignment of nqrE from different species

  • Mutation Types to Consider:

    • Conservative substitutions (e.g., Cys→Ser) to maintain structure while altering function

    • Non-conservative substitutions to dramatically alter properties

    • Deletion mutations to remove functional domains

    • Domain swapping with homologous proteins from other species

Functional Assessment Methods

  • In Vitro Activity Assays:

    • Measure dNADH oxidase activity

    • Assess Na+-stimulated, HQNO-inhibited enzyme activity

    • Quantify quinone reductase activity using dNADH:menadione oxidoreductase assays

  • Structural Analysis:

    • Circular dichroism to assess secondary structure changes

    • Limited proteolysis to examine conformational alterations

    • Iron content analysis to evaluate (Cys)4[Fe] center formation

In Vivo Phenotypic Studies

  • Growth Characterization:

    • Compare growth rates of wildtype versus mutant strains

    • Assess growth under various Na+ concentrations

    • Evaluate respiratory capacity using oxygen consumption measurements

  • Complementation Experiments:

    • Create nqrE knockout strains (e.g., using methods similar to those used for nqrM knockouts )

    • Complement with plasmids expressing mutant nqrE variants

    • Assess restoration of Na+-NQR activity

This comprehensive approach enables researchers to correlate specific structural features of nqrE with its functional roles in electron transport and Na+ translocation.

Potential of nqrE as a Vaccine Component

While current research has not directly examined nqrE as a vaccine candidate, studies on other Pasteurella multocida recombinant proteins provide a methodological framework for investigating this possibility:

Comparative Analysis with Known P. multocida Vaccine Antigens

ProteinProtective EfficacyAnimal ModelFormulationReference
PlpE (lipoprotein E)80-100% survivalMice10μg purified r-PlpE
PlpE63-100% survivalChickens100μg purified r-PlpE
PlpB (lipoprotein B)No protectionMice/ChickensPurified r-PlpB
VacJ33.3% protectionDucksSubunit vaccine with oil adjuvant
OmpH83.33% protectionDucksSubunit vaccine with oil adjuvant
Combined (VacJ+PlpE+OmpH)100% protectionDucksSubunit vaccine with oil adjuvant

Methodological Approach for nqrE Vaccine Potential

  • Antigenicity Assessment:

    • Express and purify recombinant nqrE with N-terminal His-tag

    • Evaluate antibody responses in animal models

    • Assess cross-reactivity with nqrE from different P. multocida strains

  • Protection Studies:

    • Immunize animals with purified r-nqrE

    • Challenge with virulent P. multocida strains

    • Evaluate survival rates, bacterial loads, and tissue damage

  • Combination Vaccine Approach:

    • Test nqrE in combination with known protective antigens (e.g., PlpE, OmpH)

    • Assess potential synergistic protection

    • Evaluate formulations with different adjuvants

The high sequence conservation of P. multocida proteins across strains (e.g., PlpE shows 90.8-100% identity across strains ) suggests that nqrE might similarly serve as a cross-protective antigen if it proves to be immunogenic and protective.

Maturation Factors Critical for Functional nqrE Expression

Producing functional recombinant nqrE as part of the Na+-NQR complex requires specific maturation factors, with significant implications for experimental design:

Key Maturation Factors

  • NqrM (DUF539) Protein:

    • Required for maturation of Na+-NQR

    • Facilitates formation of the (Cys)4[Fe] center between NqrD and nqrE

    • Essential for producing fully functional Na+-NQR in heterologous expression systems

  • ApbE Protein:

    • Involved in flavin attachment to Na+-NQR subunits

    • Works in conjunction with NqrM for proper complex assembly

    • Required for Na+-stimulated, HQNO-inhibited dNADH oxidase activity

Experimental Evidence for Maturation Requirements

Research has demonstrated that expression of V. harveyi Na+-NQR genes in E. coli results in high dNADH:menadione oxidoreductase activity, but Na+-stimulated, HQNO-inhibited dNADH oxidase activity is observed only when the complete set of genes including apbE and nqrM1 is expressed .

Expression ConstructdNADH:menadione ActivityNa+-stimulated, HQNO-inhibited dNADH Oxidase ActivityReference
nqr genes onlyPresentAbsent
nqr genes + apbEPresentAbsent
nqr genes + nqrMPresentAbsent
nqr genes + apbE + nqrMPresentPresent

Methodological Implications for Recombinant Expression

To produce functional recombinant nqrE as part of the Na+-NQR complex:

  • Co-expression Strategy:

    • Clone and co-express nqrE with all other nqr operon genes

    • Include maturation factors (NqrM and ApbE) in the expression system

    • Use vectors allowing coordinated expression of all components

  • Expression Host Considerations:

    • Use E. coli strains deficient in H+-translocating NADH:quinone oxidoreductase (e.g., E. coli ANN091) to facilitate specific activity measurements

    • Consider native expression hosts (e.g., Vibrio species) for more authentic complex assembly

  • Functional Verification:

    • Verify complex assembly using BN-PAGE or other native gel techniques

    • Confirm Na+ transport function through direct measurements of Na+ flux

    • Validate electron transfer by measuring NADH oxidation coupled to quinone reduction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.