Recombinant Pasteurella multocida Phosphate transport system permease protein pstC (pstC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pasteurella multocida Phosphate Transport System Permease Protein PstC (PstC) is a bioengineered protein derived from the high-affinity phosphate transport system of Pasteurella multocida. This ABC transporter permease facilitates phosphate uptake under phosphate-limited conditions and plays a critical role in bacterial survival and pathogenicity . The recombinant form is expressed in heterologous hosts (e.g., E. coli) for research and vaccine development, with applications in understanding bacterial physiology and developing therapeutic strategies .

Biochemical Role

PstC functions as an integral membrane component of the ABC transporter PstSCAB:

  • PstS: Periplasmic phosphate-binding protein .

  • PstC/PstA: Membrane permeases forming the translocation pore .

  • PstB: ATPase driving phosphate import .
    Critical residues (e.g., Arg-237 and Glu-240 in PstC) are essential for phosphate transport .

Phosphate Uptake and Regulation

PstC enables high-affinity phosphate acquisition, crucial for bacterial growth in phosphate-scarce environments . Its expression is induced under phosphate starvation, regulated by the Pho regulon .

Potential Virulence Implications

While PstC’s direct role in pathogenicity is unconfirmed, phosphate transport systems are often linked to bacterial survival in host niches . Mutations in PstC may impair phosphate uptake, affecting bacterial persistence .

Key Mutational Studies

MutationEffectSource
Arg-237 → Gln (PstC)Loss of phosphate transport (retains alkaline phosphatase repression) E. coli
Glu-240 → Gln (PstC)Impaired phosphate transport E. coli
C Deletion in PstCTruncated PstC (201 aa); suppressor mutations restore full-length protein (494 aa) Rhizobium

Vaccine Development

Recombinant PstC is explored as a subunit vaccine candidate to target Pasteurella multocida infections in livestock .

Research Reagents

Commercially available PstC variants include:

SourceExpression SystemPuritySupplier
Pasteurella multocidaE. coli≥85%Creative Biolabs
Bacillus subtilisCell-free≥85%MyBioSource
Shigella flexneriE. coli/Yeast≥85%MyBioSource

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
pstC; PM0435; Phosphate transport system permease protein PstC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
pstC
Target Protein Sequence
MLRRKTQAETNRLNHHIIELLFRQTTRFFAIFVFLLLAAVMTSLVFGSWDSFSTFGFSFL WHNDWNPVQESYGAIIPIVGTLITSFLALIIAVPISFGIAIFLTELAPEWLRRPVGTAIE MLAAIPSIIYGMWGLFIFVPLFQEHIQPSLIEWFGDLPVFSYLFSGAPFGIGLFTAGLVL AIMIIPFIAAVMRDVFTIVPAILKESAYGLGSTTWEVMWKVVLPYTKTGVVGGIMLGLGR ALGETMAVTFVIGNAFHLPESLFSPSTSIASAIANEFNEASGLQKSALMELGLILFLITT VVLSISRLLIMRIEKKEGRK
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: pmu:PM0435

STRING: 272843.PM0435

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida and what diseases does it cause?

Pasteurella multocida is a Gram-negative, nonmotile, penicillin-sensitive coccobacillus classified into five serogroups (A, B, D, E, F) based on capsular composition and 16 somatic serovars (1-16). It causes numerous diseases in animals including fowl cholera in poultry, atrophic rhinitis in pigs, and bovine hemorrhagic septicemia in cattle and buffalo. It can also cause zoonotic infections in humans, typically resulting from bites or scratches from domestic pets. Many mammals, including domestic cats and dogs, and birds harbor P. multocida as part of their normal respiratory microbiota . The bacterium can be effectively treated with beta-lactam antibiotics that inhibit cell wall synthesis, as well as with fluoroquinolones or tetracyclines .

What is the phosphate transport system (Pst) in bacteria and what role does pstC play?

The Pst system consists of four primary components: PstS, PstC, PstA, and PstB. This system works alongside regulatory genes such as phoB, phoR, and phoU to control inorganic phosphate transport in bacteria. Additional genes including phoA, phoE, and phoP regulate other forms of phosphorus metabolism . Within this system, pstC functions as a permease protein - a transmembrane component responsible for the physical transport of phosphate molecules across the bacterial membrane. This protein plays a crucial role in phosphate homeostasis, which is essential for bacterial survival and virulence in phosphate-limited environments.

Why is recombinant pstC protein production important for research applications?

Recombinant pstC protein production enables detailed structural and functional studies that would be difficult with native protein isolation. The recombinant approach allows for targeted modifications, addition of tags for purification and detection, controlled expression conditions, and scalable production. For P. multocida research specifically, recombinant proteins have proven valuable in developing subunit vaccines and understanding bacterial virulence mechanisms . Recombinant protein expression systems also facilitate the production of adequate quantities of purified protein for crystallography, antibody production, and immunological studies.

What expression systems are most effective for producing recombinant P. multocida pstC protein?

The most commonly used expression system for P. multocida proteins is E. coli, though other systems including yeast, baculovirus, and mammalian cells can also be employed depending on research requirements . For P. multocida outer membrane proteins and lipoproteins, E. coli BL21(DE3) strains combined with pET expression vectors have shown good results in producing functional recombinant proteins . When expressing pstC specifically, careful optimization of induction conditions is necessary to prevent inclusion body formation. Temperature reduction during induction (typically to 16-25°C), lower IPTG concentrations, and co-expression with chaperones may improve the solubility of this membrane protein.

What purification strategies yield the highest purity recombinant pstC protein?

A multi-step purification approach is typically required for high-purity pstC protein:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged constructs

  • Intermediate purification: Ion exchange chromatography to separate based on charge differences

  • Polishing: Size exclusion chromatography to remove aggregates and achieve high purity

For membrane proteins like pstC, detergent selection is critical throughout the purification process. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are often effective in maintaining protein stability while solubilizing the membrane component. Phosphate buffer should be avoided during purification of phosphate-binding proteins like pstC, as it may interfere with protein function assessment.

How can researchers overcome challenges in expressing membrane proteins like pstC?

Expressing membrane proteins like pstC presents several challenges including toxicity to host cells, inclusion body formation, and proper folding. Researchers can employ the following strategies:

  • Use of low-copy number plasmids or tightly controlled inducible promoters to reduce toxicity

  • Expression as fusion proteins with solubility-enhancing partners (MBP, SUMO, thioredoxin)

  • Addition of specific detergents or lipids to the culture medium

  • Co-expression with bacterial chaperones (GroEL/GroES, DnaK/DnaJ)

  • Use of specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Cell-free expression systems for particularly difficult constructs

For P. multocida proteins specifically, expressing truncated versions that exclude the transmembrane regions while retaining functional domains has been successful for structural and immunological studies .

What techniques are most informative for analyzing pstC protein structure?

Multiple complementary approaches provide comprehensive structural insights into pstC:

  • X-ray crystallography: Provides high-resolution structures but requires pure, homogeneous, and crystallizable protein samples

  • Cryo-electron microscopy: Increasingly used for membrane proteins, allowing visualization in a more native-like environment

  • Nuclear magnetic resonance (NMR) spectroscopy: Useful for dynamic regions and ligand binding studies

  • Circular dichroism spectroscopy: Provides information about secondary structure content

  • Limited proteolysis combined with mass spectrometry: Identifies domain boundaries and flexible regions

  • Computational modeling and molecular dynamics simulations: Predicts structure-function relationships

When analyzing pstC specifically, consider its association with other Pst system components, as the functional unit involves multiple proteins working together in the membrane environment.

How does the pstC protein interact with other components of the phosphate transport system?

The pstC protein functions as part of the multi-component Pst system, interacting primarily with:

  • PstA: Forms the transmembrane channel complex with pstC

  • PstS: The periplasmic phosphate-binding protein that delivers phosphate to the PstC/PstA channel

  • PstB: The ATP-binding cassette protein that provides energy for transport through ATP hydrolysis

These interactions can be studied using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, surface plasmon resonance, or crosslinking studies. In P. multocida specifically, the Pst system is likely regulated by the PhoBR two-component system in response to phosphate limitation, similar to other gram-negative bacteria . Mutation studies targeting specific residues in pstC can identify amino acids critical for protein-protein interactions within the complex.

What functional assays can determine phosphate transport activity of recombinant pstC?

Assessing the functional activity of recombinant pstC requires reconstitution of the complete Pst transport system. Several approaches include:

  • Proteoliposome reconstitution assays: Incorporate purified pstC (with other Pst components) into liposomes and measure radioactive phosphate (³²P) uptake

  • Whole-cell phosphate uptake assays: Express recombinant pstC in phosphate transport-deficient bacterial strains and measure complementation of phosphate uptake

  • ATPase activity assays: Measure ATP hydrolysis as an indirect measure of transport activity

  • Fluorescent phosphate analog transport: Use fluorescent phosphate analogs and measure their accumulation in reconstituted systems

  • Electrophysiological measurements: Study channel properties using patch-clamp techniques on reconstituted systems

These functional assays should include appropriate controls such as inactive mutants and inhibition by known phosphate transport inhibitors to validate specificity.

What adjuvant formulations optimize immune responses to recombinant P. multocida proteins?

Adjuvant selection significantly impacts vaccine efficacy for recombinant P. multocida proteins:

  • Water-in-oil-in-water adjuvants: Studies show these formulations produce superior immune responses for recombinant PMT proteins compared to aluminum gel, which is commonly used in commercial vaccines

  • Oil-based adjuvants: Single water-in-oil adjuvants have demonstrated strong results with recombinant outer membrane proteins and lipoproteins from P. multocida

  • Combination adjuvants: Formulations containing both immune stimulators (like CpG oligonucleotides) and delivery systems may further enhance responses

The choice of adjuvant should be tailored to the specific recombinant protein and target species. For pstC protein specifically, comparative studies with different adjuvant formulations would be necessary to determine optimal combinations for stimulating both humoral and cell-mediated immunity.

How can heterologous protection be assessed when developing recombinant P. multocida pstC-based vaccines?

Evaluating heterologous protection (protection against different strains or serotypes) for pstC-based vaccines requires a multi-faceted approach:

  • In vitro assessments:

    • Sequence analysis of pstC across multiple P. multocida strains to identify conserved regions

    • Cross-reactivity testing of vaccine-induced antibodies against pstC proteins from different strains

    • Epitope mapping to identify conserved B-cell and T-cell epitopes

  • In vivo challenge studies:

    • Sequential challenges with homologous and heterologous strains

    • Measurement of protection rates, bacterial loads, and clinical parameters

    • Assessment of cross-protective immunity against multiple serotypes

Research has demonstrated that recombinant PMT-C protein can provide both homologous and heterologous protection against P. multocida challenge . Similar evaluation frameworks would be applicable to pstC-based vaccine candidates, with particular attention to protection across the most clinically relevant serotypes A, B, and D.

How can CRISPR-Cas9 technology be applied to study pstC function in P. multocida pathogenesis?

CRISPR-Cas9 technology offers powerful approaches for investigating pstC function:

  • Gene knockout/knockdown: Create pstC-deficient strains to assess its role in phosphate acquisition, survival under phosphate limitation, and virulence

  • Base editing: Introduce specific mutations to identify critical residues without complete gene disruption

  • CRISPRi: Implement inducible repression of pstC to study temporal aspects of phosphate transport

  • CRISPR screening: Perform genome-wide screens to identify genetic interactions with pstC

  • Knock-in modifications: Insert reporter tags to monitor pstC expression and localization in vivo

When applying CRISPR-Cas9 to P. multocida, researchers must optimize transformation protocols, select appropriate promoters for Cas9 expression, and design guide RNAs specific to the target strain. For studying pstC specifically, complementation experiments are essential to confirm phenotypes result from pstC disruption rather than polar effects on the pst operon.

What proteomics approaches reveal the most about pstC protein interactions and modifications?

Advanced proteomics techniques provide detailed insights into pstC biology:

  • Crosslinking mass spectrometry (XL-MS): Identifies interaction partners and spatial relationships within the Pst complex

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps conformational changes upon phosphate binding or protein-protein interactions

  • Thermal proteome profiling: Assesses protein stability changes in response to ligands or environmental conditions

  • Post-translational modification (PTM) analysis: Identifies regulatory modifications like phosphorylation or acetylation

  • Quantitative proteomics: Measures changes in protein abundance under different phosphate concentrations

For membrane proteins like pstC, specialized approaches such as membrane-enriched fractionation, appropriate detergent selection for sample preparation, and targeted mass spectrometry may be necessary to overcome challenges related to hydrophobicity and lower abundance.

How does phosphate limitation affect pstC expression and bacterial virulence in animal infection models?

Understanding pstC regulation under phosphate limitation requires integrated approaches:

  • Transcriptional analysis: qRT-PCR or RNA-seq to measure pstC expression changes under varying phosphate concentrations

  • Reporter fusion constructs: pstC promoter-reporter fusions to monitor expression in real-time during infection

  • Chromatin immunoprecipitation (ChIP): Identify regulatory proteins binding to the pstC promoter region

  • In vivo expression technology (IVET): Detect pstC expression specifically during infection

  • Animal infection studies: Compare virulence of wild-type and pstC-mutant strains under controlled phosphate conditions

Research in other bacterial pathogens shows that phosphate limitation typically upregulates pst system components through the PhoBR two-component system and can enhance virulence factor expression. In P. multocida, similar regulatory mechanisms likely exist, though species-specific patterns may emerge in different host environments and infection sites.

What biosafety requirements apply to research with recombinant P. multocida proteins?

Research with recombinant P. multocida proteins requires compliance with institutional and national biosafety regulations:

  • Institutional Biosafety Committee (IBC) approval for recombinant DNA research

  • Proper biosafety training for all personnel (General Lab Safety and Biosafety Training)

  • Current protocol registration with the IBC

  • Adherence to NIH Guidelines for Research Involving Recombinant DNA Molecules, regardless of funding source

For recombinant pstC specifically, while the protein itself presents minimal risk, expression in systems containing the complete P. multocida genome requires appropriate containment measures. Work should be conducted at Biosafety Level 2 if using pathogenic strains as the source of genetic material.

What are the key considerations for experimental design when studying pstC in P. multocida virulence?

Robust experimental design for pstC virulence studies should address:

When studying membrane proteins like pstC, consider creating reporter strains to monitor expression without disrupting function, or using conditional expression systems to study essential genes that cannot be completely deleted.

How can structural biology approaches identify potential inhibitors of pstC for antimicrobial development?

Structure-based drug design targeting pstC involves multiple complementary approaches:

  • High-resolution structure determination: Using X-ray crystallography or cryo-EM to solve the pstC structure

  • In silico screening: Virtual screening of compound libraries against identified binding pockets

  • Fragment-based screening: Biophysical methods to identify small molecular fragments that bind to pstC

  • Structure-activity relationship (SAR) studies: Systematic modification of lead compounds to improve potency and selectivity

  • Molecular dynamics simulations: Study protein dynamics and inhibitor interactions

  • Target validation: Confirm that inhibitor binding to pstC disrupts phosphate transport and bacterial survival

Targeting pstC as an antimicrobial strategy is particularly promising given its essential role in phosphate acquisition and its location in the bacterial membrane, making it accessible to drugs without the need to penetrate the cytoplasm.

What comparative genomics approaches reveal about pstC conservation across P. multocida strains?

Comparative genomics provides valuable insights into pstC evolution and potential as a conserved vaccine target:

  • Whole-genome sequence comparison: Analyze pstC sequences across multiple strains and serotypes

  • Phylogenetic analysis: Construct evolutionary relationships based on pstC sequence variation

  • Selection pressure analysis: Calculate dN/dS ratios to identify conserved functional regions under purifying selection

  • Epitope conservation: Map potential B-cell and T-cell epitopes across strains

  • Genomic context analysis: Examine conservation of the entire pst operon structure

Such analyses can identify highly conserved regions of pstC that may serve as optimal targets for broad-spectrum vaccines or antimicrobials. They can also reveal strain-specific variations that might impact phosphate transport efficiency or regulation in different host environments.

How do host phosphate levels during infection influence P. multocida pstC expression and pathogenesis?

The relationship between host phosphate status and P. multocida pathogenesis represents an emerging research area:

  • Transcriptional profiling: RNA-seq of bacteria during infection to monitor pstC expression

  • Metabolomic analysis: Measure phosphate levels in different host tissues during infection

  • Fluorescent reporters: Monitor pstC expression in real-time during infection

  • Host manipulation: Experimentally alter host phosphate levels to observe effects on bacterial virulence

  • Simultaneous host-pathogen transcriptomics: Examine correlations between host phosphate regulation genes and bacterial pstC expression

Understanding this relationship could reveal new therapeutic approaches targeting phosphate homeostasis during infection or explain tissue tropism based on phosphate availability in different host niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.