Recombinant Pasteurella multocida Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; PM1688; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-527
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
ubiB
Target Protein Sequence
MQIKDISHLYNIIKTFLLYGIDEALPQHRYTRAIRCWRKTLFWLRNQHKDKTFGLRLRLA LQELGPVWIKLGQMLSTRRDLFPPDIADELALLQDQVDPFDGKIARAQIEKALGAPLETW FDEFNETALASASIAQVHTAKFKQNAPHLENRLAGKEVVLKVLRPNIQQMINADLSLMYK VASWIPRIKAEGRRLRPVEVVREYEKNLRDELDLRREMANAIQLRANFENSPMLYIPEMY KQFCHQTVIVMERIYGIPVSNIEELHANGTNMKLLAERGVQVFFTQVFRDSFFHADMHPG NIFVNRAHPDDPQYIGIDCGIVGRLNDHDKRYLAESFVAFFNRDYRRVAEMHVASGWTPK DTNIDDFEQAFREVCEPIFAKPLSEISFGHVLLNLFNVAREYNMEVQPQLVLLQKTLLYI EGLGRQLYPQLDLWDTAKPFLQKWLDEQMGIKAFTKSVKQKLPYWREHLVDLPENVMDAL AQQKIIADELIHLNRTLAKKRNIPHFTSFILGLCTGLAIWLLIYLLS
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links

KEGG: pmu:PM1688

STRING: 272843.PM1688

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Pasteurella multocida and why is its UbiB protein significant?

Pasteurella multocida is a gram-negative coccobacillus commonly found in the respiratory tract of animals such as cats, dogs, and birds. It causes various diseases including hemorrhagic septicemia in cattle and duck cholera in poultry. The UbiB protein belongs to an enigmatic family of kinase-like proteins strongly tied to ubiquinone (Coenzyme Q) biosynthesis, which is essential for bacterial respiration and energy production . UbiB's significance stems from its critical role in maintaining the ubiquinone pool necessary for bacterial survival, making it a potential target for antimicrobial development.

What is the function of ubiquinone in bacterial metabolism?

Ubiquinone (Coenzyme Q) is a redox-active lipid produced across all domains of life that functions as an essential electron mediator in respiratory chains and oxidative phosphorylation . In bacterial metabolism, ubiquinone serves as a crucial electron carrier in the electron transport chain, facilitating energy production through ATP synthesis. It also plays a significant role in redox regulation and maintaining cellular redox balance . Studies in trypanosomatids have shown that UQ depletion can trigger cell death, highlighting its essential nature in microbial survival .

What are the main virulence factors of P. multocida and how do they relate to UbiB function?

P. multocida possesses several important virulence factors that contribute to its pathogenicity:

Virulence FactorFunctionRelevance to Infection
Lipopolysaccharide (LPS)Endotoxin activity, membrane integrityInduces inflammatory response
Capsular polysaccharideAnti-phagocytic, adherenceProtection against host defenses
Outer membrane proteins (OMP)Adhesion, nutrient acquisitionAttachment to host cells, immunogens
Iron-regulated proteins (IROMP)Iron acquisitionSurvival in iron-limited environments
Extracellular enzymesTissue damageInvasiveness, spread within tissues

While UbiB is not traditionally classified as a virulence factor, its role in ubiquinone biosynthesis is essential for bacterial energy metabolism and survival during infection . Disruption of ubiquinone biosynthesis could impair bacterial growth and potentially attenuate virulence, making UbiB an indirect contributor to pathogenicity.

What are the structural features of the UbiB protein family?

The UbiB protein family exhibits several distinctive structural features that differentiate it from conventional kinases despite sharing kinase-like domains:

The crystal structure of human COQ8A (a UbiB homolog) revealed conserved structural features that sterically occlude the active site . These proteins exhibit low levels of autophosphorylation but lack kinase activity in trans. Instead, UbiB proteins appear to leverage their ATPase activity to enable proper ubiquinone biosynthesis through mechanisms that remain incompletely understood .

Key structural features include:

  • Kinase-like domains with unique modifications

  • ATPase activity centers

  • Isoprenoid lipid-binding regions that interact with CoQ intermediates

  • Membrane-interaction domains, particularly with cardiolipin-containing membranes

  • Conserved sequence motifs across species suggesting functional importance of specific residues

How does the UbiB protein interact with other components of the ubiquinone biosynthesis pathway?

UbiB proteins function within a complex network of interactions in the ubiquinone biosynthesis pathway. In eukaryotes, UbiB homologs (COQ8 in yeast) can stabilize protein subcomplexes and enable the accumulation of late-stage ubiquinone intermediates when overexpressed . This suggests that UbiB may serve as a critical organizational component within the biosynthetic machinery.

Studies indicate that UbiB likely:

  • Facilitates the formation of biosynthetic protein complexes (sometimes called "Complex Q" in eukaryotes)

  • Potentially extracts lipid intermediates from membranes

  • Uses ATPase activity to drive conformational changes necessary for complex assembly or function

  • Interacts with enzymes catalyzing adjacent steps in the biosynthetic pathway

Additional yeast UbiB family members like Cqd1/2p have been implicated in ubiquinone distribution, pointing toward broader roles in ubiquinone homeostasis beyond just biosynthesis .

What expression systems are most effective for producing recombinant P. multocida UbiB?

While specific optimization data for P. multocida UbiB expression is limited, successful recombinant P. multocida protein production strategies can be applied:

The expression of recombinant P. multocida proteins typically utilizes E. coli as the host system. For example, studies with other P. multocida proteins like VacJ, PlpE, and OmpH have successfully used E. coli BL21(DE3) with the pET43.1a vector system . These proteins were expressed with his-tags for purification purposes, resulting in high protein yields suitable for further applications.

Key considerations for expression system selection include:

  • Vector choice: pET series vectors provide strong inducible expression

  • Host strain: BL21(DE3) and derivatives offer reduced protease activity

  • Fusion tags: His-tags facilitate purification, while fusion partners like MBP or SUMO may improve solubility

  • Induction conditions: Temperature, inducer concentration, and timing should be optimized

How can Design of Experiments (DoE) methodology optimize recombinant UbiB production?

Design of Experiments (DoE) methodology provides a powerful and efficient approach to optimize recombinant protein production with fewer experiments than traditional one-factor-at-a-time methods . For UbiB optimization, DoE can systematically evaluate multiple interdependent parameters:

The DoE approach involves:

  • Screening phase: Use factorial design to identify significant factors affecting expression

    • 2^k factorial design to screen variables with minimal experiments

    • Plackett-Burman designs for screening many factors

  • Optimization phase: Apply response surface methodology (RSM)

    • Central composite designs to model quadratic effects

    • Box-Behnken designs as an alternative with fewer experimental points

  • Validation: Confirm optimal conditions with verification runs

ParameterTypical RangeOptimization Approach
Expression temperature16-37°CLower temperatures often improve solubility
IPTG concentration0.1-1.0 mMStart with 0.5 mM and adjust based on expression
Induction time3-24 hoursBalance between yield and protein stability
Media compositionLB, TB, 2xYT, M9Rich media often improve yield
Cell density at inductionOD600 0.6-1.0Optimize based on protein characteristics

Statistical analysis using ANOVA can identify significant factors and interactions, followed by response surface modeling to determine optimal conditions .

What purification strategies yield the highest purity and activity of recombinant UbiB?

Based on successful purification of other recombinant P. multocida proteins and membrane-associated proteins like UbiB, an effective purification strategy would include:

  • Initial extraction:

    • For membrane-associated proteins like UbiB, gentle detergent solubilization may be necessary

    • Buffer optimization to maintain protein stability and solubility

  • Affinity chromatography:

    • Nickel affinity purification for His-tagged proteins

    • Careful optimization of imidazole concentrations for binding and elution

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and assess oligomeric state

    • Ion exchange chromatography for increased purity if necessary

  • Quality assessment:

    • SDS-PAGE to verify purity

    • Western blot to confirm identity

    • Activity assays to verify functional state (typically ATPase activity for UbiB proteins)

Studies with recombinant P. multocida proteins VacJ, PlpE, and OmpH demonstrated successful purification using affinity chromatography, resulting in proteins with molecular weights of 84.4 kDa, 94.8 kDa, and 96.7 kDa, respectively, that retained immunological activity .

What assays can be used to evaluate the enzymatic activity of UbiB?

Although the precise enzymatic function of UbiB remains enigmatic, several assays can be employed to assess its activity:

  • ATPase assays:

    • Malachite green phosphate assay to measure released inorganic phosphate

    • Coupled enzyme assays (with pyruvate kinase and lactate dehydrogenase) to monitor ATP hydrolysis

    • Radiolabeled [γ-32P]ATP assays for high sensitivity

  • Lipid binding assays:

    • Fluorescence-based assays using environmentally sensitive probes

    • Surface plasmon resonance (SPR) with immobilized lipids

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Functional complementation:

    • Genetic complementation assays in UbiB-deficient bacterial strains

    • Restoration of ubiquinone synthesis in deficient strains

  • Ubiquinone quantification:

    • HPLC analysis of cellular ubiquinone content

    • LC-MS/MS for precise quantification of ubiquinone and intermediates

The activity of UbiB is likely influenced by membrane composition, as studies with homologs have shown that cardiolipin-containing membranes can activate ATPase activity .

How can LC-MS/MS be used to analyze ubiquinone biosynthesis in P. multocida?

LC-MS/MS provides a powerful tool for analyzing ubiquinone and its biosynthetic intermediates in bacterial systems:

Quinone components can be extracted from bacterial cells using organic solvents and analyzed by LC-TOF/MS. For example, in Trypanosoma cruzi epimastigotes, the major ubiquinone species UQ 9 displayed an accurate molecular weight of m/z 795.630 with a molecular formula of C54H82O4 . When the [M+H]+ was selected as the precursor ion for MS/MS, it generated a fragment ion with m/z 197.082, derived from its quinone ring .

The methodology involves:

  • Extraction of quinone components from bacterial cells

  • HPLC separation of ubiquinone and intermediates

  • MS analysis for accurate mass determination

  • MS/MS fragmentation for structural confirmation

  • Quantification using appropriate standards

This approach can be used to:

  • Identify the major ubiquinone species in P. multocida (likely UQ 8 or UQ 9)

  • Detect accumulation of biosynthetic intermediates when UbiB function is inhibited

  • Monitor changes in ubiquinone pools under different growth conditions

  • Evaluate the effect of potential UbiB inhibitors on ubiquinone biosynthesis

What evidence supports UbiB as a potential antimicrobial target against P. multocida?

Several lines of evidence support the potential of UbiB as an antimicrobial target:

  • Essential pathway: Ubiquinone is essential for respiratory chain function and redox balance in bacteria. Depletion of the ubiquinone pool can trigger bacterial death, as demonstrated in studies with Trypanosoma brucei .

  • Existing inhibitor effects: Inhibitors targeting enzymes in the ubiquinone biosynthesis pathway have shown trypanocidal activity, suggesting antimicrobial potential. For example, oxazinoquinoline derivatives inhibiting COQ7 demonstrated significant antitrypanosomal activity against Trypanosoma cruzi .

  • Genetic evidence: The ubiquinone synthesis pathway has been identified as a promising drug target for Chagas disease caused by T. cruzi infection . Similar principles likely apply to P. multocida infections.

  • Unique features: Bacterial UbiB proteins have unique structural features compared to human homologs, potentially allowing for selective targeting.

  • Broad conservation: UbiB is conserved across bacterial species, suggesting potential for broad-spectrum antimicrobial development.

What approaches can be used to develop inhibitors targeting P. multocida UbiB?

Development of effective inhibitors targeting P. multocida UbiB would involve several strategic approaches:

  • Structure-based design:

    • Utilizing crystal structures or homology models of P. multocida UbiB

    • Virtual screening of compound libraries against the ATP-binding site

    • Fragment-based approaches to develop high-affinity inhibitors

  • Biochemical screening:

    • High-throughput ATPase inhibition assays

    • Screening focused libraries of known kinase inhibitors that might cross-react

    • Phenotypic screening for compounds that reduce ubiquinone levels

  • Repurposing strategy:

    • Testing known inhibitors of related proteins

    • Evaluating existing drugs with potential to interact with UbiB

  • Natural product exploration:

    • Screening microbial extracts for UbiB inhibitory activity

    • Investigating plant-derived compounds with antimicrobial properties

  • Medicinal chemistry optimization:

    • Structure-activity relationship studies of promising hit compounds

    • Improving pharmacokinetic properties while maintaining selectivity

Oxazinoquinoline derivatives that inhibit human COQ7 have shown cross-reactivity with trypanosomal COQ7, resulting in suppression of ubiquinone synthesis and antitrypanosomal activity . Similar principles could be applied to identify compounds that selectively inhibit P. multocida UbiB.

How can molecular dynamics simulations enhance understanding of UbiB function?

Molecular dynamics (MD) simulations provide valuable insights into protein function that are difficult to obtain experimentally, particularly for enigmatic proteins like UbiB:

MD simulations can reveal:

  • Structural dynamics:

    • Conformational changes during ATP binding and hydrolysis

    • Identification of flexible regions important for function

    • Analysis of allosteric networks within the protein

  • Protein-substrate interactions:

    • Binding modes of ubiquinone precursors

    • Energy profiles for substrate recognition

    • Identification of key residues for substrate specificity

  • Membrane interactions:

    • Embedding of UbiB in lipid bilayers

    • Effect of membrane composition on protein dynamics

    • Mechanisms of substrate extraction from membranes

A typical MD protocol would involve:

  • System preparation: Building a protein-membrane system with explicit solvent

  • Equilibration: Gradually releasing constraints to reach equilibrium

  • Production: Running multiple microsecond-scale simulations

  • Analysis: Examining RMSD, RMSF, hydrogen bonds, salt bridges, and essential dynamics

Advanced techniques such as metadynamics or umbrella sampling could calculate free energy landscapes for substrate binding and conformational changes, providing mechanistic insights into UbiB's role in ubiquinone biosynthesis.

What are the challenges in crystallizing recombinant UbiB proteins and how can they be overcome?

Crystallizing membrane-associated proteins like UbiB presents several challenges:

Challenges:

  • Membrane association affects solubility and homogeneity

  • Conformational heterogeneity from multiple functional states

  • Stability issues without native binding partners

  • Hydrophobic regions causing aggregation

Strategies for successful crystallization:

  • Protein engineering approaches:

    • Surface entropy reduction: Replacing flexible surface residues with alanines

    • Domain truncation: Removing flexible regions

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Stabilizing antibody fragments or nanobodies

  • Expression optimization:

    • Low-temperature expression to improve folding

    • Co-expression with chaperones

    • Testing multiple orthologs from different bacterial species

  • Crystallization techniques:

    • Lipidic cubic phase crystallization for membrane proteins

    • Microseeding to improve crystal nucleation

    • High-throughput screening of crystallization conditions

    • In situ proteolysis during crystallization

  • Alternative structural approaches when crystallization fails:

    • Cryo-EM for structure determination without crystals

    • SAXS for low-resolution envelope determination

    • NMR for dynamic regions and smaller domains

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.