Recombinant Pasteurella multocida Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression system:

  • Recombinant Lgt is typically expressed in E. coli with an N-terminal His-tag for affinity purification .

  • Purity exceeds 90% as confirmed by SDS-PAGE and Western blot .

Vaccine development:

  • While recombinant Lgt itself has not been directly tested as a vaccine antigen, studies on related P. multocida lipoproteins (e.g., PlpE) show high protective efficacy in animal models . For example:

    • PlpE conferred 80–100% survival in mice and 63–100% in chickens against lethal challenges .

    • Combination vaccines with PlpE and other antigens (e.g., OmpH) achieved 100% protection in ducks .

Antibiotic target exploration:

  • Inhibitors of Lgt homologs (e.g., in E. coli) demonstrate bactericidal effects by disrupting lipoprotein anchoring, suggesting potential for targeting P. multocida Lgt .

Table 2: Conserved Functional Residues (Inferred from Homologs)

ResidueRole in CatalysisSpecies Validated
Y26Substrate bindingE. coli
N146Stabilizes active siteE. coli
G154Structural flexibilityE. coli

Future Directions

  • Therapeutic potential: Lgt inhibitors, if developed, could disrupt P. multocida membrane biogenesis, offering novel antimicrobial strategies .

  • Vaccine adjuvants: Recombinant Lgt may enhance immune responses when combined with other antigens, similar to PlpE-based formulations .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
lgt; PM0080; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
lgt
Target Protein Sequence
MQSNYFSFPQFDPVIFEIGPIGLRWYGLMYLLGFLFARWLAVKRANQTGSGWTTDQVDSL LFNGFMGVFLGGRIGYVLFYQFDYFLQDPAYLFRVWEGGMSFHGGLIGVILAMLITAKIQ KRGFWQTADFVAPLIPFGLGMGRIGNFINDELWGRVTDVPWAVLFPSGGYLPRHPSQLYE AVLEGIVLFFILNWYIKKPRPIGATAGLFLLGYGIFRFIVEFFREPDAQLGLYFGQHISM GQILSTPMILIGAVIMLVAYQSAGKKREIL
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: pmu:PM0080

STRING: 272843.PM0080

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida Prolipoprotein diacylglyceryl transferase (lgt) and what is its function?

Prolipoprotein diacylglyceryl transferase (lgt) is a critical enzyme that catalyzes the first step in the biogenesis of Gram-negative bacterial lipoproteins. In Pasteurella multocida, as in other Gram-negative bacteria, lgt transfers diacylglyceryl from phosphatidylglycerol to a conserved cysteine residue in prolipoprotein substrates, forming a thioether bond. This modification is essential for proper lipoprotein anchoring to bacterial membranes. The protein plays a crucial role in bacterial growth, membrane integrity, and pathogenesis, making it a significant focus for both basic microbiology research and antimicrobial drug development .

The lgt enzyme from P. multocida strain Pm70 has been characterized as a membrane-bound protein of approximately 270 amino acids. Its function is highly conserved across Gram-negative bacteria, reflecting its fundamental importance in bacterial physiology. In P. multocida, proper functioning of this enzyme is essential for maintaining outer membrane integrity and supporting the bacterium's ability to cause diseases such as fowl cholera in poultry, atrophic rhinitis in pigs, and hemorrhagic septicemia in cattle .

How is recombinant P. multocida lgt typically expressed and purified for research purposes?

Recombinant P. multocida lgt is typically expressed using heterologous expression systems, with Escherichia coli being the most common host organism. The process generally involves:

  • Gene cloning: The lgt gene sequence from P. multocida (often strain Pm70) is amplified and inserted into a suitable expression vector containing appropriate promoters and purification tags.

  • Transformation and expression: The recombinant plasmid is introduced into E. coli expression strains. Expression conditions must be optimized considering that lgt is a membrane protein, which can be challenging to express in soluble form .

  • Purification strategy: The recombinant protein is typically fused with affinity tags (such as His-tag) to facilitate purification using affinity chromatography. Additional purification steps may include ion exchange chromatography and size exclusion chromatography.

  • Protein characterization: The purified protein is verified through methods like SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity .

When expressing membrane-associated proteins like lgt, researchers often need to employ specialized approaches such as detergent solubilization or the use of membrane mimetics to maintain proper folding and function of the recombinant protein.

What methodologies are available for measuring lgt enzymatic activity in vitro?

Several methodologies have been developed to assess lgt enzymatic activity in vitro, with the most common approach being:

The glycerol phosphate release assay: This method measures the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. Specifically:

  • The peptide substrate is typically derived from known lipoproteins, such as Pal (Pal-IAAC, where C is the conserved cysteine modified by Lgt).

  • During the reaction, glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released from phosphatidylglycerol as Lgt catalyzes the transfer reaction.

  • The detection of G3P specifically can be accomplished using a coupled luciferase reaction system .

Another approach involves using radiolabeled phosphatidylglycerol substrates to track the transfer of diacylglyceryl groups to peptide substrates, followed by thin-layer chromatography or other separation techniques for quantification. Mass spectrometry-based approaches can also be employed to directly detect the modified peptide products.

For inhibitor screening, researchers have developed high-throughput adaptations of these assays that allow for rapid evaluation of potential lgt inhibitors, as demonstrated in studies that identified the first Lgt inhibitors with IC50 values in the sub-micromolar range (0.24 μM, 0.93 μM, and 0.18 μM for compounds G9066, G2823, and G2824, respectively) .

How can researchers evaluate the effects of lgt inhibition or deletion on bacterial membrane integrity?

Researchers can employ multiple complementary approaches to evaluate the effects of lgt inhibition or deletion on bacterial membrane integrity:

  • Membrane permeability assays: Using fluorescent dyes that only penetrate compromised membranes (such as propidium iodide) to assess membrane integrity. Increased fluorescence indicates greater membrane permeabilization .

  • Serum sensitivity assays: Measuring bacterial survival upon exposure to serum, as compromised outer membranes typically lead to increased sensitivity to serum killing. Research has shown that Lgt depletion in clinical uropathogenic E. coli strains leads to increased sensitivity to serum killing .

  • Antibiotic susceptibility testing: Determining minimum inhibitory concentration (MIC) changes for various antibiotics. Lgt inhibition typically increases sensitivity to antibiotics that normally cannot penetrate the intact outer membrane.

  • Lipoprotein localization studies: Analyzing subcellular fractionation to track the localization of lipoproteins in membrane versus soluble fractions. Western blotting can be used to detect specific lipoproteins and determine if they remain properly localized after lgt inhibition .

  • Electron microscopy: Directly visualizing membrane morphology changes using transmission electron microscopy.

  • Analysis of phospholipid-linked lipoproteins: Specifically for lgt studies, researchers can examine the association of lipoproteins with phosphatidylglycerol. Studies have shown that Lgt depletion leads to a significant loss of diacylglyceryl-modified phosphatidylglycerol-linked lipoproteins (DGPLP) and decreased phosphatidylglycerol association of other lipoproteins like Pal .

How can recombinant P. multocida lgt be utilized in vaccine development strategies?

Recombinant P. multocida lgt has significant potential in vaccine development strategies through several approaches:

Research indicates that recombinant protein approaches can reduce tissue damage and bacterial colonization to varying degrees when compared to conventional vaccines, suggesting that targeted recombinant protein vaccines may offer advantages over traditional whole-cell killed vaccines .

What are the advantages of targeting lgt for antimicrobial development compared to other bacterial targets?

Targeting lgt for antimicrobial development offers several distinct advantages compared to other bacterial targets:

  • Essential for bacterial viability: Lgt catalyzes the first step in lipoprotein biogenesis, which is crucial for bacterial growth and survival. Inhibition of Lgt leads to bactericidal effects in wild-type E. coli and A. baumannii strains, demonstrating its potential as an effective antimicrobial target .

  • Reduced potential for resistance development: Unlike inhibitors targeting other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein (lpp) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors. This suggests that targeting Lgt may overcome common resistance mechanisms that invalidate inhibitors of downstream steps of bacterial lipoprotein biosynthesis and transport .

  • Broad-spectrum potential: The lgt enzyme is highly conserved across Gram-negative bacteria, including important pathogens like P. multocida, E. coli, and A. baumannii, suggesting that inhibitors could have broad-spectrum activity.

  • Membrane effects: Lgt inhibition leads to permeabilization of the outer membrane and increased sensitivity to serum killing and antibiotics, which could potentially enhance the efficacy of co-administered conventional antibiotics .

  • Novel target class: As the first inhibitors of Lgt have only recently been described, this represents a novel class of antibacterial targets with minimal pre-existing resistance mechanisms in clinical settings.

Studies have demonstrated that molecules identified as Lgt inhibitors potently inhibit Lgt biochemical activity in vitro with IC50 values in the sub-micromolar range and exhibit bactericidal activity against wild-type bacterial strains, validating Lgt as a novel druggable antibacterial target .

What controls should be included when studying the effects of lgt depletion or inhibition?

When studying the effects of lgt depletion or inhibition, researchers should include the following essential controls:

  • Genetic complementation: For deletion or depletion studies, include a strain complemented with a functional copy of the lgt gene to verify that observed phenotypes are specifically due to lgt loss rather than secondary mutations or polar effects. Inducible expression systems can be particularly valuable for this purpose .

  • Inactive enzyme controls: Include mutant versions of lgt with alterations in catalytic residues as negative controls to distinguish between enzymatic and structural roles of the protein.

  • Off-target effect controls: For inhibitor studies, include:

    • Strains with decreased expression of lgt to confirm that inhibitors act through the expected target

    • Testing against lgt-independent microorganisms to verify specificity

    • Biochemical assays with purified enzyme to confirm direct inhibition

  • Substrate controls: When assessing enzymatic activity, include modified substrate controls such as peptides with the conserved cysteine mutated to alanine (e.g., Pal-IAA instead of Pal-IAAC) to confirm specificity of the reaction .

  • Phenotypic validation controls: Include tests that validate the expected consequences of lgt inhibition, such as:

    • Membrane integrity assays

    • Lipoprotein localization studies

    • Antibiotic susceptibility testing

    • Analysis of phosphatidylglycerol-linked lipoprotein forms

  • Time-course controls: Monitor phenotypes over different time points to distinguish between primary and secondary effects of lgt depletion or inhibition.

Research has demonstrated the importance of multiple validation approaches when studying Lgt inhibitors, including both biochemical assays measuring glycerol phosphate release and genetic approaches using inducible deletion strains to confirm that observed phenotypes match those expected from lgt inhibition .

What in vivo models are appropriate for evaluating P. multocida lgt-based vaccine candidates?

Several in vivo models have been established for evaluating P. multocida lgt-based vaccine candidates, with selection depending on the target host species and disease being studied:

  • Duck models for fowl cholera:

    • Ducks are natural hosts for P. multocida and develop duck cholera, making them highly relevant for vaccine studies.

    • Vaccination protocols typically involve intramuscular or subcutaneous administration of recombinant proteins formulated with appropriate adjuvants.

    • Challenge is typically performed via intraperitoneal injection with virulent P. multocida strains (e.g., 20 LD50 doses of P. multocida A:1).

    • Evaluation metrics include survival rates, antibody responses (measured by ELISA), histopathological examination, and tissue bacterial load detection .

  • Mouse models:

    • While not natural hosts, mice provide a convenient model for initial screening of vaccine candidates.

    • Studies have established the immunogenicity and protective efficacy of certain P. multocida lipoproteins in mouse models.

    • Mouse models allow for more detailed immunological studies due to the availability of reagents and genetically modified strains.

  • Rabbit models:

    • Rabbits have been used to evaluate the safety and immunogenicity of recombinant P. multocida proteins including lipoproteins.

    • The larger size allows for collection of greater serum volumes for antibody analysis.

  • Target species-specific models:

    • For vaccines aimed at particular hosts (cattle, pigs, poultry), species-specific models provide the most relevant data.

    • These models evaluate parameters including antibody titers, protection against challenge, reduction in clinical signs, and bacterial clearance.

Research has shown that in duck models, recombinant protein vaccines can provide significant protection, with combination vaccines containing multiple antigens achieving up to 100% protection compared to 50% for conventional killed vaccines. Additionally, these vaccines were shown to reduce tissue damage and bacterial colonization based on histopathological examination and tissue bacterial load detection (p<0.001) .

How does P. multocida lgt compare to lgt proteins from other bacterial pathogens?

Pasteurella multocida lgt shares important structural and functional similarities with lgt proteins from other bacterial pathogens, while also exhibiting some distinct characteristics:

Understanding both the similarities and differences between P. multocida lgt and its counterparts in other pathogens is valuable for developing broad-spectrum antimicrobials targeting this essential bacterial enzyme.

What are the current challenges and future directions in P. multocida lgt research?

Current challenges and future directions in P. multocida lgt research span several interconnected areas:

  • Structural characterization: Despite its importance, detailed structural information on P. multocida lgt remains limited. Future research should focus on determining the three-dimensional structure of the enzyme, potentially through crystallography or cryo-electron microscopy, to inform rational drug design efforts.

  • Inhibitor development: While initial Lgt inhibitors have been identified for related bacterial enzymes, there is a need to develop potent and selective inhibitors specifically optimized for P. multocida lgt. Future work should explore:

    • Structure-activity relationships of existing inhibitors

    • Development of P. multocida-specific assays for high-throughput screening

    • In vivo efficacy testing of promising candidates

  • Resistance mechanisms: Although deletion of major lipoproteins does not appear to confer resistance to Lgt inhibition, understanding potential alternative resistance mechanisms will be crucial for therapeutic development. Research should investigate whether mutations affecting the conserved phosphatidylglycerol binding site might emerge, despite potentially resulting in loss of function .

  • Vaccine optimization: While recombinant P. multocida proteins have shown promise as vaccine components, further optimization is needed:

    • Determining optimal antigen combinations and doses

    • Exploring alternative adjuvant formulations

    • Developing delivery systems that enhance immune responses

    • Conducting field trials in relevant animal populations

  • Host-pathogen interactions: Further research is needed to understand how lgt-dependent lipoproteins interact with host immune systems, particularly in the context of P. multocida's diverse host range and tissue tropisms.

  • Comparative genomics: Expanding our understanding of lgt variation across P. multocida strains and serotypes could provide insights into strain-specific virulence mechanisms and inform more broadly effective intervention strategies.

Future research integrating these approaches will be essential for harnessing the full potential of P. multocida lgt as both an antimicrobial target and a component of next-generation vaccines.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.