Recombinant Pasteurella multocida Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
htpX; PM0468; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
htpX
Target Protein Sequence
MMRILLFLATNMAVLVVFNIILSLTGIQAQDATGLLLMAALFGFSGSLISLFLSKTMALR AVGAEVIKQPRNDMERWLVNTVRSQAERANLPMPDVAIYHSEDVNAFATGPSKNNSLVAV STGLLRAMTQDEAEAVLAHEVAHIKNGDMVTMTLLQGVLNTFVIFVSRMIAKVVSSNRDG ESSTGIYFLVSMVLEILFGFLASMIAMWFSRYREFRADAGSAKLVGKHKMIAALQRLQRL HEPQELEGQLAAFAINGKRGGLAALFMSHPPLEKRIAALQQLDSFK
Uniprot No.

Target Background

Database Links

KEGG: pmu:PM0468

STRING: 272843.PM0468

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida Protease HtpX and what is its biological significance?

Pasteurella multocida Protease HtpX is a bacterial protease enzyme found in P. multocida, a gram-negative bacterium responsible for various diseases in animals and humans. HtpX belongs to the family of membrane-bound proteases that play roles in protein quality control and virulence. The biological significance of HtpX lies in its potential contribution to bacterial survival mechanisms and pathogenicity. Similar to other P. multocida proteins, HtpX may be involved in host-pathogen interactions, particularly in modulating immune responses during infection .

P. multocida is a significant pathogen that causes various diseases, including duck cholera (duck hemorrhagic septicemia), a highly contagious disease affecting the poultry industry . The bacterium is also the leading cause of wound infections in humans following animal bites or scratches, and can cause serious respiratory diseases in mammals .

How is the htpX gene isolated from Pasteurella multocida for recombinant expression?

The htpX gene can be isolated from Pasteurella multocida through whole genome sequencing of the bacterial strain. Using the genomic DNA as a template, researchers design specific primers containing recognition sites for restriction endonucleases (e.g., BamHI and SmaI) based on the known sequence of htpX. For example, primers such as P1:5′-CGGATCCTGCTGCTAAAACATTCACTGTT-3′ and P2:5′-TCCCCGGGTTTATAGGAATGCAAGCGC-3′ have been used to amplify the htpX gene .

The PCR amplification process typically involves:

  • Extraction of genomic DNA from P. multocida strains

  • PCR amplification using the designed primers

  • Verification of the amplified product by gel electrophoresis

  • Restriction enzyme digestion of the PCR product

  • Ligation into an appropriate expression vector

This technique is similar to methods used for cloning other P. multocida genes such as VacJ, PlpE, and OmpH, which have been successfully cloned into vectors like pET-43.1a for recombinant protein expression .

What expression systems are optimal for producing recombinant P. multocida HtpX?

Based on research with other recombinant proteins from P. multocida, Escherichia coli expression systems such as T7 SHuffle and T7 Express strains have proven effective for expressing recombinant proteins . These systems offer several advantages for HtpX expression:

  • Vector selection: pET series vectors (such as pET-52b) containing thrombin cleavage sites and histidine tags facilitate purification and are compatible with HtpX expression .

  • Expression optimization: For stable cytoplasmic expression, modification of the protein construct may be necessary, such as removing the N-terminal signal peptide and first few residues of the protein, as demonstrated with PmSLP-1 .

  • Growth conditions: Optimal conditions typically include:

    • Growth at 37°C until mid-log phase

    • Induction with IPTG (0.5 mM final concentration)

    • Post-induction growth at a lower temperature (20°C) overnight to enhance protein folding

  • Media selection: For standard protein production, LB media with appropriate antibiotics is sufficient. For specialized applications like selenomethionine-labeled protein production, minimal media supplemented with specific amino acids may be used .

What purification strategies yield the highest purity and activity for recombinant HtpX protease?

Purification of recombinant HtpX protease likely requires a multi-step approach similar to those used for other P. multocida recombinant proteins:

  • Initial capture: Affinity chromatography using nickel or cobalt resins to capture His-tagged recombinant HtpX.

  • Intermediate purification: Ion exchange chromatography to separate HtpX from proteins with similar affinity for metal ions.

  • Polishing step: Size exclusion chromatography to achieve final purity and remove aggregates.

  • Tag removal: If necessary, enzymatic cleavage (e.g., using thrombin) to remove fusion tags that might interfere with activity studies .

The purification process must be optimized to maintain protease activity while achieving high purity. Special considerations for HtpX purification include:

  • Inclusion of appropriate protease inhibitors during early purification steps to prevent degradation by host cell proteases

  • Buffer optimization to stabilize the protease during purification

  • Temperature control during purification to minimize autoproteolysis

Researchers should verify purification results using SDS-PAGE and Western blot analysis with specific antibodies, as done with other P. multocida recombinant proteins .

How can the enzymatic activity of recombinant HtpX be measured and characterized?

Characterization of HtpX enzymatic activity should include multiple complementary approaches:

  • Substrate specificity profiling:

    • Using synthetic peptide libraries to identify preferred cleavage sites

    • Testing natural protein substrates to determine physiological targets

    • Monitoring cleavage products by mass spectrometry or HPLC

  • Kinetic parameters determination:

    • Measurement of Km, Vmax, and kcat using appropriate substrates

    • Calculation of catalytic efficiency (kcat/Km)

    • Analysis of substrate inhibition or activation patterns

  • Biochemical characterization:

    • pH optimum and stability profile

    • Temperature optimum and thermal stability

    • Effects of metal ions and cofactors on activity

    • Inhibition studies with various protease inhibitors

For quantitative analysis, researchers can monitor activity through:

  • Release of chromogenic or fluorogenic groups from synthetic substrates

  • Degradation of protein substrates visualized by SDS-PAGE

  • Specialized protease activity assays based on the expected properties of HtpX

The significant increase in fermentation level (61.9-fold) reported for recombinant DX-3-htpX protease compared to DX-3 protease suggests that activity assays should be designed to detect substantial differences in enzymatic efficiency .

What structural features of HtpX contribute to its proteolytic mechanism?

While specific structural information about P. multocida HtpX is limited in the provided research materials, the structural analysis approach would likely include:

  • Computational analysis:

    • Homology modeling based on related protease structures

    • Identification of the catalytic domain and active site residues

    • Prediction of substrate binding pockets and specificity determinants

  • Experimental structure determination:

    • X-ray crystallography techniques as applied to other P. multocida proteins

    • Preparation of protein crystals using methods such as hanging drop vapor diffusion

    • Optimization of crystallization conditions (e.g., using ammonium tartrate with PEG 8000 or sodium thiocyanate with ammonium sulfate and PEG 3350, as used for PmSLP-1)

    • Cryo-protection of crystals for data collection

  • Structure-function analysis:

    • Site-directed mutagenesis of predicted catalytic residues

    • Functional assays to correlate structural features with enzymatic activity

    • Analysis of protein-substrate interactions through molecular docking

Researchers investigating HtpX structure should consider the possible presence of conserved zinc-binding motifs characteristic of metalloproteases, transmembrane domains that might affect solubility during recombinant expression, and potential conformational changes upon substrate binding.

How does recombinant HtpX contribute to virulence in P. multocida infections?

The role of HtpX in P. multocida virulence likely involves complex mechanisms similar to other P. multocida virulence factors:

  • Potential immunomodulatory effects:

    • HtpX may target host defense proteins similar to how PmSLP interacts with complement components

    • The protease might degrade specific host proteins involved in immune response

    • HtpX could potentially interfere with signaling pathways in host cells

  • Contribution to bacterial survival:

    • HtpX might participate in stress response mechanisms

    • The protease could be involved in nutrient acquisition during infection

    • HtpX may play a role in biofilm formation or maintenance

  • Tissue invasion and colonization:

    • Potential degradation of extracellular matrix components

    • Modification of bacterial surface proteins to evade host defenses

    • Role in adhesion to host tissues, similar to other P. multocida proteins

Research approaches to study HtpX virulence contributions would include in vitro infection models, comparative virulence studies with htpX knockout strains, and analysis of HtpX expression patterns during different stages of infection .

What are the technical challenges in developing recombinant HtpX as a vaccine component?

Development of recombinant HtpX as a vaccine component faces several technical challenges that must be addressed through systematic research:

  • Immunogenicity optimization:

    • Determination of the optimal protein conformation for inducing protective immunity

    • Identification of immunodominant epitopes

    • Avoidance of epitopes that might induce non-protective or harmful immune responses

  • Adjuvant selection:

    • Identification of appropriate adjuvants for HtpX (water-in-oil or oil-coated adjuvants have been effective for other P. multocida recombinant proteins)

    • Optimization of protein-adjuvant formulations

    • Evaluation of adjuvant safety profiles

  • Immune response characterization:

    • Assessment of antibody responses (titers, isotypes, neutralizing capacity)

    • Evaluation of cell-mediated immunity

    • Investigation of potential immune polarization (Th1/Th2 balance)

  • Efficacy considerations:

    • Protection levels against homologous and heterologous challenge

    • Duration of immunity

    • Potential for immune enhancement when combined with other antigens

Researchers must be aware that not all recombinant P. multocida proteins induce protective immunity. For example, recombinant PmOmpA was found to elicit a strong Th2-type immune response characterized by high IgG1 antibody production, but failed to provide protection against homologous challenge in mice . In contrast, combination vaccines containing multiple recombinant proteins (rVacJ+rPlpE+rOmpH) have shown 100% protection in duck models .

How can RNA-seq and proteomics be integrated to understand the regulation of htpX expression?

Advanced multi-omics approaches to study htpX regulation would involve:

  • Transcriptomic analysis:

    • RNA-seq under various environmental conditions (pH, temperature, nutrient limitation)

    • Identification of promoter elements and transcription factors regulating htpX

    • Analysis of htpX expression during different growth phases

    • Comparison of expression patterns between virulent and avirulent strains

  • Proteomic approaches:

    • Quantitative proteomics to correlate htpX transcript levels with protein abundance

    • Post-translational modification analysis of HtpX

    • Protein-protein interaction studies to identify regulatory partners

    • Subcellular localization studies under different conditions

  • Integration of datasets:

    • Correlation analysis between transcriptomic and proteomic data

    • Pathway analysis to identify networks involving htpX

    • Identification of co-regulated genes and proteins

    • Construction of regulatory models for htpX expression

  • Validation experiments:

    • Reporter gene assays to confirm promoter activity

    • Chromatin immunoprecipitation to identify transcription factor binding

    • Directed mutagenesis of regulatory elements

    • In vivo expression studies during infection

This integrative approach would provide comprehensive insights into the factors controlling htpX expression and help elucidate its role in P. multocida physiology and pathogenesis.

How does HtpX compare to other characterized P. multocida recombinant proteins?

ProteinMolecular WeightExpression SystemPurification MethodBiological FunctionVaccine PotentialReference
HtpXNot fully specifiedE. coli (likely)Not fully specifiedProtease activity with 61.9-fold increased fermentation level compared to nativeUnknown
VacJ84.4 kDa (recombinant)E. coliHis-tag purificationLipoprotein, virulence-associated33.3% protection alone, 100% in combination
PlpE94.8 kDa (recombinant)E. coliHis-tag purificationLipoprotein, complement-mediated killing83.33% protection alone, 100% in combination
OmpH96.7 kDa (recombinant)E. coliHis-tag purificationMajor outer membrane protein, pore protein family83.33% protection alone, 100% in combination
OmpANot specifiedE. coliNot fully specifiedAdhesin, binds host cells and ECM moleculesDetrimental to protection, elicits Th2 response
PmSLP~35 kDa (mature)E. coli T7 ExpressHis-tag purificationBinds complement factor I, facilitates C3b/C4b cleavageRemarkable protection with single dose

This comparative analysis highlights that HtpX represents a distinct class of P. multocida proteins (proteases) compared to the more extensively studied outer membrane proteins and lipoproteins. The enhanced activity of recombinant HtpX suggests unique properties that warrant further investigation in the context of bacterial physiology and potential applications.

What methodological improvements can be applied from other P. multocida protein studies to enhance HtpX research?

Several methodological advances from studies of other P. multocida proteins can be adapted to enhance HtpX research:

  • Protein engineering strategies:

    • N-terminal modification to improve solubility and expression (removing signal peptides and first few residues as done with PmSLP-1)

    • Surface entropy reduction for crystallization (as applied to PmSLP-1)

    • Domain-based expression approach to identify functional regions

  • Expression optimization techniques:

    • Use of specialized E. coli strains like T7 SHuffle that enhance disulfide bond formation

    • IPTG concentration optimization and temperature reduction after induction

    • Consideration of alternative host systems for proteins with toxicity issues

  • Functional analysis approaches:

    • Development of animal models for in vivo testing

    • Challenge studies with precisely defined bacterial doses (e.g., 20 LD50 doses used for P. multocida A:1)

    • Histopathological examination and tissue bacterial load detection to assess protection mechanisms

  • Structural biology techniques:

    • Selenomethionine incorporation for phase determination in crystallography

    • Cryo-EM analysis for structural determination of protein complexes

    • Streak seeding to improve crystal quality and growth rate

By applying these refined methodologies, researchers can accelerate progress in understanding HtpX structure, function, and potential applications in vaccines or therapeutic interventions.

What are the most promising applications of recombinant HtpX in vaccine development?

Given the significant enhancement in activity observed with recombinant DX-3-htpX protease (61.9-fold increase) , several promising vaccine development strategies warrant investigation:

  • Attenuated protease vaccine component:

    • Engineering catalytically inactive HtpX variants that maintain immunogenicity

    • Development of protease-resistant adjuvant formulations

    • Evaluation of HtpX in combination with established protective antigens like PlpE and OmpH

  • Multi-epitope vaccine design:

    • Identification of immunodominant B-cell and T-cell epitopes from HtpX

    • Creation of chimeric proteins incorporating protective epitopes from multiple P. multocida antigens

    • Design of DNA vaccines encoding selected HtpX epitopes

  • Delivery system optimization:

    • Evaluation of nanoparticle-based delivery for HtpX antigens

    • Investigation of mucosal delivery routes relevant to P. multocida infection

    • Development of prime-boost strategies incorporating protein and DNA-based HtpX vaccines

  • Cross-protection studies:

    • Assessment of HtpX conservation across P. multocida serotypes

    • Evaluation of cross-protective potential against heterologous strains

    • Investigation of broad-spectrum protection against multiple Pasteurellaceae family members

Researchers must carefully consider potential immune polarization effects, as seen with PmOmpA which induced a strong but non-protective Th2 response , and focus on generating balanced immune responses that provide effective protection.

How can structural biology techniques advance our understanding of HtpX function and regulation?

Advanced structural biology approaches will be crucial for elucidating HtpX function:

  • Integrated structural analysis:

    • X-ray crystallography of HtpX in different conformational states

    • Cryo-EM studies of HtpX complexes with substrates or regulatory proteins

    • NMR spectroscopy for dynamic regions and interaction interfaces

    • Small-angle X-ray scattering (SAXS) for solution structure analysis

  • Structure-guided functional studies:

    • Identification of catalytic residues through structure-based mutagenesis

    • Substrate specificity analysis based on binding pocket architecture

    • Rational design of specific inhibitors targeting the active site

    • Engineering of HtpX variants with altered specificity or activity

  • Regulatory mechanism investigation:

    • Structural analysis of potential allosteric sites

    • Identification of protein-protein interaction interfaces

    • Characterization of post-translational modifications affecting activity

    • Molecular dynamics simulations to understand conformational changes

  • Comparative structural biology:

    • Structural comparison with HtpX from other bacterial species

    • Analysis of evolutionary conservation in functional domains

    • Investigation of structural adaptations specific to P. multocida

These structural biology approaches, combined with functional studies, will provide comprehensive insights into HtpX biology and potentially reveal novel therapeutic targets or vaccine design strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.