Recombinant Pasteurella multocida Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant CrcB is primarily utilized in:

  1. Antigen Characterization:

    • Used in ELISA and Western blot to study antibody responses .

    • Evaluated as a potential vaccine candidate due to surface exposure in P. multocida .

  2. Structural Biology:

    • Serves as a template for resolving ion transporter mechanisms via crystallography .

  3. Comparative Genomics:

    • Homology analysis reveals >98% sequence conservation across P. multocida serotypes, suggesting cross-protective vaccine potential .

Comparative Analysis with Other P. multocida Recombinant Proteins

ProteinFunctionVaccine EfficacyMolecular Weight
CrcBFluoride ion transportUnder investigation~14 kDa
PlpEOuter membrane lipoprotein70–80% protection~94.8 kDa
OmpHOuter membrane proteinHigh immunogenicity~96.7 kDa
PMT-CToxin fragmentCross-protective~48 kDa

Data synthesized from .

Challenges and Future Directions

  • Functional Validation: Limited data exist on CrcB’s role in P. multocida pathogenesis. Knockout studies are needed to confirm its contribution to virulence .

  • Adjuvant Optimization: Current formulations (e.g., aluminum gel) may require refinement to enhance immunogenicity .

  • Cross-Protection Trials: Testing against diverse P. multocida serotypes (A, B, D) is essential for vaccine development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please specify your preferred format in the order notes and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For shipments requiring dry ice, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C and aliquot for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag type, please communicate your preference and we will prioritize developing the specified tag.
Synonyms
crcB; PM1630; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
crcB
Target Protein Sequence
MISVGQQIIFISSGAALGALSRWGLGLLLNPLFSAFSLGTLVANYLGCLIIGVFLAFFWQ YPQCSAEWRLFFVTGFLGSLTTFSTFSAEVIENLIQQKWLAGLMLASGHLLGCLLFTALG VFIWRYWQ
Uniprot No.

Target Background

Function
CrcB is crucial for reducing fluoride concentration within cells, thereby mitigating its toxicity.
Database Links

KEGG: pmu:PM1630

STRING: 272843.PM1630

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of CrcB homolog in Pasteurella multocida?

CrcB homolog in Pasteurella multocida functions primarily as a fluoride ion transporter. Based on structural and functional analyses, this protein plays a role in fluoride ion efflux, which helps protect bacterial cells from fluoride toxicity. The protein belongs to a conserved family of membrane proteins that maintain fluoride homeostasis across various bacterial species. Unlike other well-characterized P. multocida proteins, CrcB's role in virulence has limited experimental validation, making it an area requiring further knockout studies to establish its contribution to bacterial pathogenicity.

How does CrcB compare structurally and functionally to other key P. multocida proteins?

CrcB differs significantly from other well-studied P. multocida proteins in terms of structure, molecular weight, and known functions. The following table provides a comparative analysis:

ProteinFunctionVaccine EfficacyMolecular Weight
CrcBFluoride ion transportUnder investigation~14 kDa
PlpEOuter membrane lipoprotein70–80% protection~94.8 kDa
OmpHOuter membrane proteinHigh immunogenicity~96.7 kDa
PMT-CToxin fragmentCross-protective~48 kDa

Unlike PlpE and OmpH, which are outer membrane proteins with established roles in bacterial adhesion and immunogenicity, CrcB is a smaller transmembrane protein with a more specialized cellular function. While PlpE and OmpH have been extensively studied for vaccine development with documented protection rates of 70-80%, CrcB's potential in vaccine development remains largely unexplored .

What expression systems are most effective for producing recombinant CrcB protein?

The most effective expression system for recombinant CrcB protein production is E. coli, particularly using the pET expression system. This approach involves:

  • Gene amplification: PCR amplification of the crcB gene from P. multocida genomic DNA using specifically designed primers that contain appropriate restriction sites.

  • Vector construction: Insertion of the amplified crcB gene into a suitable expression vector such as pET43.1a between appropriate restriction sites (typically SmaI and HindIII) using homologous recombination techniques .

  • Transformation: Transformation of the recombinant plasmid into an expression host like E. coli BL21(DE3), which is optimized for high-level protein expression.

  • Expression induction: Using IPTG to induce protein expression, typically at 37°C for 4-6 hours, though optimization of temperature and duration may be necessary for optimal yield.

  • Purification: His-tag affinity chromatography is commonly employed, followed by SDS-PAGE and Western blot verification using anti-His antibodies to confirm protein identity and purity .

This methodology has been successfully applied to other P. multocida proteins like VacJ, PlpE, and OmpH, with expected yields sufficient for experimental applications.

What are the optimal conditions for preserving structural integrity and bioactivity of purified recombinant CrcB?

To maintain the structural integrity and bioactivity of purified recombinant CrcB protein:

  • Storage buffer: Use a Tris/PBS-based buffer (pH 8.0) with 6% trehalose as a stabilizing agent. This composition helps maintain protein stability during freeze-thaw cycles .

  • Aliquoting: Divide the purified protein into small working aliquots immediately after purification to avoid repeated freeze-thaw cycles, which can significantly reduce bioactivity.

  • Storage temperature: Store the protein at -20°C/-80°C for long-term storage, with -80°C being preferable for extended periods.

  • Glycerol addition: Add glycerol to a final concentration of 30-50% before freezing to prevent ice crystal formation that can denature the protein .

  • Reconstitution protocol: When needed, reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, centrifuging the vial briefly before opening to ensure all content is at the bottom .

  • Working storage: For active research, maintain working aliquots at 4°C for up to one week rather than subjecting the protein to repeated freeze-thaw cycles .

These conditions are particularly important for membrane proteins like CrcB, which tend to be less stable than soluble proteins due to their hydrophobic domains.

What evidence exists for CrcB's contribution to P. multocida virulence mechanisms?

Current evidence for CrcB's contribution to P. multocida virulence remains limited compared to other virulence factors. Research findings suggest:

  • Gene expression analysis: Unlike proteins such as Pm0442, which shows dramatic upregulation during infection, CrcB's expression patterns during host infection are not well documented in current literature .

  • Functional validation: Limited experimental data exists regarding CrcB's direct role in P. multocida pathogenesis. Knockout studies, which would definitively confirm its contribution to virulence, have not been extensively reported in the available literature.

  • Comparative genomics: While CrcB is conserved across different P. multocida serotypes, suggesting evolutionary importance, this conservation alone does not confirm a virulence role.

  • Potential indirect mechanisms: As a fluoride transporter, CrcB may contribute to bacterial survival under environmental stress conditions, potentially including host defense mechanisms that utilize antimicrobial compounds, but this connection requires further investigation.

For definitive evidence of CrcB's role in virulence, research would need to include:

  • Creation of crcB deletion mutants using homologous recombination techniques similar to those used for other P. multocida genes

  • Comparative virulence studies between wild-type and ΔcrcB strains in appropriate animal models

  • Complementation studies to confirm phenotype restoration

How does CrcB expression vary across different P. multocida serotypes and how might this impact pathogenesis studies?

The expression and conservation of CrcB across P. multocida serotypes presents both challenges and opportunities for pathogenesis research:

  • Genomic conservation: Comparative genomic analyses suggest CrcB is present across the five recognized capsular serogroups (A, B, D, E, and F) of P. multocida, though sequence variation may exist . Unlike PlpE, which shows 90.8-100% homology among different isolates, or VacJ, which demonstrates 98.9-99.3% conservation across serotypes, specific data on CrcB homology across serotypes is not extensively documented in the literature .

  • Host-specific expression patterns: P. multocida strains show different virulence characteristics depending on host species and serotype. For example:

    • Type A predominantly affects birds and causes fowl cholera

    • Type B and E cause hemorrhagic septicemia in cattle and buffalo

    • Type D is associated with atrophic rhinitis in swine

CrcB expression may vary according to these host-pathogen interactions, potentially influencing its role in different disease manifestations .

  • Research implications: When designing pathogenesis studies involving CrcB, researchers should:

    • Use genome sequencing to confirm CrcB sequence in their specific isolate

    • Consider serotype-specific variations when interpreting results

    • Include multiple serotypes in comparative studies to determine if CrcB function is conserved across the species

    • Account for potential differences in regulation that may affect CrcB expression under various experimental conditions

These considerations will help ensure that findings regarding CrcB's role in pathogenesis can be appropriately contextualized within the broader understanding of P. multocida virulence mechanisms.

How might CrcB interact with host immune receptors compared to other P. multocida proteins?

The potential interaction between CrcB and host immune receptors represents a complex and largely unexplored research area. Based on comparative analysis with other P. multocida proteins:

This represents a significant knowledge gap in P. multocida research and offers opportunities for novel discoveries regarding bacterial protein-host immune system interactions.

What genomic approaches can elucidate CrcB evolution and functional conservation across bacterial species?

Advanced genomic approaches to study CrcB evolution and functional conservation should include:

  • Comparative genomics pipeline:

    • Genome-wide sequence alignment of CrcB homologs across diverse bacterial species

    • Identification of conserved domains and motifs critical for function

    • Analysis of selection pressure (dN/dS ratios) across different regions of the gene

    • Examination of genomic context to identify conserved operons or gene clusters

  • Phylogenetic analysis:

    • Construction of maximum-likelihood phylogenetic trees using CrcB sequences

    • Comparison with species phylogeny to identify instances of horizontal gene transfer

    • Correlation of CrcB clades with ecological niches and pathogenicity

  • Structural bioinformatics:

    • Homology modeling based on known crystal structures of related fluoride channels

    • Prediction of functional residues through evolutionary trace analysis

    • Molecular dynamics simulations to assess structural stability across variant forms

  • CRISPR-based functional screening:

    • Creation of CrcB variant libraries through targeted mutagenesis

    • Functional complementation assays in fluoride-sensitive strains

    • High-throughput screening for variants with altered transport efficiency

  • Transcriptomic correlation:

    • RNA-seq analysis across different growth conditions and fluoride concentrations

    • Identification of co-regulated genes that might function in concert with CrcB

    • Comparison of expression patterns across different bacterial species

This multifaceted approach would provide insights into how CrcB has evolved across bacterial species while maintaining its core function in fluoride transport, potentially revealing adaptations specific to the P. multocida lifestyle and pathogenicity.

How does CrcB compare with other P. multocida proteins as a potential vaccine candidate?

When evaluating CrcB as a potential vaccine candidate compared to other well-studied P. multocida proteins, several factors must be considered:

  • Immunogenicity comparison:

    • PlpE: Demonstrated 70-80% protection in mice and 63-100% protection in chickens against lethal challenge with P. multocida A:1, A:3, and A:4 strains

    • OmpH: Shows high immunogenicity with proven protective efficacy in multiple animal models

    • VacJ: Provides significant protection when combined with other antigens, with 100% protection observed in ducks when combined with PlpE and OmpH

    • CrcB: Limited data on immunogenicity and protective efficacy currently available

  • Structural characteristics affecting vaccine potential:

    • Unlike surface-exposed proteins (PlpE, OmpH), CrcB's predicted transmembrane localization may limit its accessibility to antibodies

    • CrcB's smaller size (~14 kDa compared to >90 kDa for PlpE and OmpH) might affect its immunogenicity

    • Conformational epitopes critical for neutralizing antibody generation may be difficult to maintain in recombinant CrcB formulations

  • Cross-protection potential:

    • PlpE sequences show 90.8-100% homology across P. multocida isolates, contributing to its cross-protective capabilities

    • The degree of CrcB conservation across serotypes requires further characterization to assess cross-protection potential

  • Practical considerations for vaccine development:

    • Expression and purification challenges may differ between CrcB and other P. multocida proteins

    • Adjuvant optimization requirements may vary; current formulations like aluminum gel used with other proteins may require refinement for CrcB-based vaccines

Based on available evidence, CrcB currently shows less promise as a standalone vaccine candidate compared to PlpE or OmpH, but may have potential as part of a multi-antigen formulation or for specific applications where its unique properties offer advantages.

What methodological approaches would optimize a CrcB-based vaccine formulation?

To optimize a CrcB-based vaccine formulation, researchers should consider the following methodological approaches:

  • Antigen design optimization:

    • Identify and focus on immunogenic epitopes through computational prediction and experimental validation

    • Consider creating fusion proteins with known immunogenic carriers to enhance presentation

    • Evaluate both full-length CrcB and targeted peptide fragments to determine optimal immunogenicity

    • Explore polytope approaches similar to those used for PlpE, where multiple epitopes are combined into a single construct

  • Expression system selection:

    • Compare protein yield and conformational integrity across different expression systems (E. coli, yeast, baculovirus)

    • Optimize codon usage for the selected expression system to maximize protein production

    • Consider specialized membrane protein expression systems to maintain native conformation

  • Adjuvant formulation:

    • Test water-in-oil-in-water adjuvants, which have shown superior results compared to aluminum gel formulations with other P. multocida proteins

    • Evaluate oil-based adjuvants that provided 100% protection when combined with recombinant VacJ, PlpE, and OmpH proteins in duck models

    • Consider immunostimulatory complexes (ISCOMs) or liposomal formulations to enhance antigen presentation

  • Delivery platform considerations:

    • Evaluate DNA vaccines encoding CrcB as an alternative to protein-based approaches

    • Consider viral vector delivery systems to enhance cell-mediated immune responses

    • Explore mucosal delivery routes to target respiratory infections at their primary site

  • Combination strategies:

    • Test CrcB in combination with established protective antigens like PlpE and OmpH

    • Evaluate prime-boost strategies using different formulations

    • Consider inclusion of CrcB epitopes in multi-antigen constructs designed for broad protection

  • Immune response evaluation:

    • Assess both humoral (antibody) and cell-mediated immune responses

    • Measure cross-protective potential against multiple P. multocida serotypes

    • Consider challenge studies in relevant animal models beyond mice, such as poultry, cattle, or swine depending on the target application

These methodological approaches would help overcome the challenges associated with CrcB's structural properties and limited characterization, potentially enabling its development as a component of effective vaccine formulations against P. multocida infections.

What are the primary technical challenges in purifying functional recombinant CrcB protein?

Purifying functional recombinant CrcB protein presents several technical challenges that researchers must address:

  • Membrane protein solubilization:

    • CrcB's predicted transmembrane domains create hydrophobicity challenges

    • Selection of appropriate detergents is critical (commonly used options include n-dodecyl-β-D-maltoside, CHAPS, or Triton X-100)

    • Detergent concentration must be optimized to solubilize without denaturing the protein

  • Expression strategies:

    • Toxic effects on expression hosts may occur due to membrane integration

    • Lower expression yields compared to soluble proteins are common

    • Consider fusion tags that enhance solubility (MBP, SUMO) in addition to purification tags

    • Evaluation of specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Maintaining native conformation:

    • Verification of proper folding through functional assays is essential

    • Circular dichroism spectroscopy can help assess secondary structure integrity

    • Native-PAGE and size exclusion chromatography can verify oligomeric state

  • Functional validation challenges:

    • Development of fluoride transport assays to confirm activity of purified protein

    • Use of reconstituted liposomes or nanodiscs to assess membrane protein function

    • Fluorescence-based assays using fluoride-sensitive probes to measure transport activity

  • Stability considerations:

    • Buffer optimization to prevent aggregation during concentration steps

    • Addition of stabilizing agents such as glycerol (30-50%) and trehalose (6%)

    • Limited shelf-life requiring careful storage at -80°C in small aliquots

  • Purification strategy:

    • Two-step purification combining affinity chromatography with size exclusion or ion exchange

    • Careful detergent exchange during purification steps

    • Monitoring protein quality throughout the purification process using dynamic light scattering

These challenges explain why membrane proteins like CrcB are less extensively characterized than soluble proteins such as toxin fragments or surface-exposed antigens, despite their biological importance.

What experimental approaches can distinguish CrcB's role in fluoride transport from potential roles in virulence?

Distinguishing CrcB's primary role in fluoride transport from potential contributions to virulence requires multifaceted experimental approaches:

  • Genetic manipulation strategies:

    • Creation of precise crcB deletion mutants using homologous recombination techniques similar to those used for Pm0442

    • Construction of complementation strains expressing wild-type CrcB

    • Development of point mutants with specifically disrupted fluoride transport activity but intact protein expression

    • Creation of conditional expression systems to modulate CrcB levels during infection

  • Functional transport assays:

    • Development of fluoride-specific transport assays using fluorescent probes

    • Measurement of bacterial survival in high-fluoride environments

    • Comparison of fluoride sensitivity between wild-type and ΔcrcB strains

    • Fluoride accumulation measurements in bacterial cells using ion-selective electrodes

  • Virulence phenotype characterization:

    • In vitro adhesion and invasion assays comparing wild-type and ΔcrcB strains

    • Macrophage survival and replication studies

    • Biofilm formation capacity assessment

    • Comparative transcriptomics to identify affected virulence pathways

  • In vivo infection models:

    • Challenge studies in appropriate animal models with wild-type and ΔcrcB strains

    • Bacterial load determination in tissues following infection

    • Histopathological examination to assess tissue damage

    • Measurement of inflammatory responses using cytokine profiling

    • Complementation studies to confirm phenotype restoration

  • Molecular interaction studies:

    • Identification of protein-protein interactions using pull-down assays

    • Bacterial two-hybrid screening to identify interaction partners

    • Localization studies using fluorescent protein fusions

    • Co-immunoprecipitation experiments to confirm interactions in vivo

  • Environmental response characterization:

    • Examination of CrcB expression under different stress conditions

    • Assessment of the impact of host defense mechanisms on CrcB expression

    • Evaluation of growth in various media mimicking host environments

These approaches would collectively provide evidence to differentiate between CrcB's housekeeping function in fluoride transport and any potential direct or indirect roles in P. multocida virulence or host colonization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.