Recombinant Pasteurella multocida Protein CysZ homolog (cysZ)

Shipped with Ice Packs
In Stock

Description

Functional Context and Homology

CysZ is implicated in sulfur metabolism, specifically in cysteine biosynthesis. Homologs of CysZ in other bacteria, such as Escherichia coli, are known to regulate sulfate transport and assimilation. In P. multocida, CysZ may play a role in:

  • Sulfur assimilation: Critical for bacterial survival under nutrient-limited conditions.

  • Stress response: Potential involvement in oxidative stress mitigation via cysteine production.

Notably, P. multocida research has prioritized virulence factors (e.g., PMT toxin , outer membrane proteins ), leaving CysZ underexplored. Comparative genomic analyses suggest CysZ is conserved across Pasteurellaceae, hinting at fundamental metabolic roles .

Current Applications

  • Antigen production: Utilized for antibody generation in immunological assays.

  • Enzymatic studies: Structural analysis to elucidate cysteine biosynthesis mechanisms.

Unanswered Questions

  • Pathogenicity linkage: No direct evidence ties CysZ to P. multocida virulence, unlike well-characterized factors such as PMT or Pm0442 .

  • Host interaction: Its role in infection dynamics (e.g., immune evasion) remains unstudied.

Comparative Analysis with Related Proteins

ProteinFunctionRole in VirulenceResearch Status
PMTToxin; disrupts host cell signalingMajor virulence factor Extensively studied
PlpEOuter membrane lipoproteinVaccine candidate Clinical trials ongoing
CysZSulfur metabolismHypothetical; unconfirmed Preclinical exploration

Future Directions

  • Functional knockout studies: To assess CysZ’s necessity in P. multocida survival or pathogenesis.

  • Structural resolution: X-ray crystallography or cryo-EM to map active sites.

  • Vaccine development: If immunogenic, could serve as a component in multi-antigen formulations.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us and we will prioritize developing it according to your request.
Synonyms
cysZ; PM1694; Sulfate transporter CysZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
cysZ
Target Protein Sequence
MLSHAELKQGFHYFMMGWHLITQKGLRRFVIMPILLNIVLLSGLFWLFITQIEKMIGMLM LSIPDWLSWLSSILLIFAILMILVLFYFVFTTLSGFIAAPFNGLLAEKVEKMLTGENLVE GSVWDFMKDIPRMLGREWQKLVYSLPKLIILFLLGFVPVLGQSVIPIIVTLFTAWMMAIQ YCDYPFDNHKVPFFVMKAELAEKRALSLSFGGLVMLCTFIPLVNLVVIPVAVCGATAMWV THFRDHLAMKPLNQEGVSRVSTVSIVK
Uniprot No.

Target Background

Function
High affinity, high specificity proton-dependent sulfate transporter, responsible for mediating sulfate uptake. It provides the sulfur source for the cysteine synthesis pathway.
Database Links

KEGG: pmu:PM1694

STRING: 272843.PM1694

Protein Families
CysZ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of P. multocida CysZ homolog and how does it compare to characterized CysZ proteins?

The P. multocida CysZ homolog likely shares structural similarities with other characterized CysZ proteins. Based on structural studies of CysZ from other organisms, it would be expected to be an alpha-helical integral membrane protein with two long transmembrane helices (H2b and H3a) and two pairs of shorter helices (H4b-H5a and H7-H8) that only partially insert into the membrane, forming a funnel or tripod-like shape . The protein likely has an extra-membranous hydrophilic "head" comprising an iris-like arrangement of short helices and kinked helices .

Comparative analysis across bacterial species shows CysZ proteins have remarkable structural conservation. For example, CysZ from Pseudomonas denitrificans and E. coli share 40.5% sequence identity, suggesting the P. multocida homolog would maintain the core structural elements while potentially having species-specific adaptations .

What expression systems are most effective for producing recombinant P. multocida CysZ?

For expression of membrane proteins like CysZ, E. coli-based systems remain the first choice due to their efficiency and scalability. A structural genomics approach used for other CysZ proteins involved screening 63 different bacterial homologs for expression and stability in detergents . For P. multocida CysZ specifically:

  • Consider using pET-based expression vectors with a C-terminal His-tag to facilitate purification

  • Test expression in different E. coli strains (BL21(DE3), C41(DE3), C43(DE3)), as membrane protein expression can be strain-dependent

  • Optimize induction conditions: lower temperatures (16-20°C) and IPTG concentrations (0.1-0.5 mM) often yield better-folded membrane proteins

  • Screen various detergents for extraction efficiency during protocol development

Selenomethionine-derivatized protein may also be produced for phase determination in crystallographic studies, as was successfully done with CysZ from I. loihiensis and P. fragi .

What are the conserved motifs in CysZ that should be preserved in recombinant constructs?

Two highly conserved motifs have been identified in CysZ proteins that likely play critical roles in the protein's function:

  • ExVE motif: In P. denitrificans CysZ, the aspartates E103 and E106 interact with R129, N184 and R110, H185, respectively

  • QYxDYPxDNHK motif: Contains conserved residues that form an intricate network of hydrogen bonds and salt bridges

These motifs should be preserved in any recombinant constructs of P. multocida CysZ, as they likely contribute to the core structural integrity of the protein. Any tags or modifications should be designed to avoid disrupting these regions.

What are the most effective methods for purifying P. multocida CysZ for structural and functional studies?

Based on successful purification of other CysZ proteins, a recommended protocol would include:

  • Solubilization from membranes using mild detergents (DDM, LDAO, or C12E8)

  • Initial purification using immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography (SEC) for further purification and assessment of oligomeric state

  • Optional ion exchange chromatography step if higher purity is required

For structural studies specifically, detergent screening is crucial as it significantly impacts crystallization. The structures of I. loihiensis, P. fragi, and P. denitrificans CysZ were all determined after optimization of detergent conditions and crystal forms .

How can I assess the oligomeric state of recombinant P. multocida CysZ?

CysZ proteins have been observed to form various oligomeric assemblies, most notably hexamers with D3 symmetry arranged as a trimer of dimers . To assess the oligomeric state of P. multocida CysZ:

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Blue native PAGE to preserve non-covalent interactions

  • Analytical ultracentrifugation (AUC) to determine molecular weight in solution

  • Crosslinking studies using specific cysteine mutants, as demonstrated with L161C-A164C mutations in P. fragi and I. loihiensis CysZ

The crystal structure of P. denitrificans CysZ revealed a hexameric assembly with an antiparallel membrane protein arrangement, which might serve as a model for the P. multocida homolog .

What strategies can be employed to determine the membrane topology of P. multocida CysZ?

Understanding the membrane topology of CysZ is critical given its unusual arrangement. Based on studies with other CysZ proteins, recommended approaches include:

  • Cysteine accessibility studies: Single cysteine mutants can be designed along key helices and tested for accessibility to membrane-impermeable labeling reagents

  • Fluorescence-based approaches: As demonstrated with helix H4 mutants in I. loihiensis CysZ, where only the topmost residue (R132C) was accessible to fluorophores

  • Protease protection assays in proteoliposomes with directionally reconstituted protein

  • Computational topology prediction validated by experimental approaches

Position in IlCysZResidue Mutated to CysteineFluorescence IntensityMembrane Accessibility
Top of helix H4R132CHighExposed outside membrane
Middle of helix H4Various positionsLowEmbedded in membrane

How can I measure sulfate transport activity of recombinant P. multocida CysZ?

To assess the functional activity of recombinant P. multocida CysZ, a proteoliposome-based transport assay is recommended:

  • Reconstitute purified CysZ into liposomes (typically using E. coli polar lipids and cholesterol)

  • Preload the proteoliposomes with an appropriate buffer (e.g., 200 mM Tris/Mes, pH 7.5)

  • Initiate transport by adding radiolabeled sulfate (35SO4²-) at defined concentrations (typically 1 mM)

  • Terminate reactions at specific time points and filter proteoliposomes

  • Quantify incorporated radioactivity using scintillation counting

This approach has been successfully used with other CysZ proteins and allows for the manipulation of internal and external buffer compositions to study the impact of ion gradients .

Is P. multocida CysZ transport activity dependent on ion gradients or membrane potential?

Based on studies with other CysZ proteins, it would be valuable to investigate whether P. multocida CysZ function is linked to ion gradients or membrane potential. Experimental approaches should include:

  • Assessing SO4²- uptake in the presence of ionophores that dissipate specific ion gradients:

    • Gramicidin for dissipating both Na+ and H+ gradients

    • Valinomycin for manipulating K+ gradients and membrane potential

  • Creating defined membrane potentials using K+ gradients and valinomycin:

    • Hyperpolarization (inside-negative) conditions

    • Depolarization (inside-positive) conditions

Studies with other CysZ homologs showed that hyperpolarization did not markedly increase sulfate flux, while depolarization (inside positive potential of approximately +118 mV) increased uptake activity by about 40% . Testing whether P. multocida CysZ shows similar behavior would provide insights into its transport mechanism.

What is the specificity of P. multocida CysZ for different anions?

To characterize the substrate specificity of P. multocida CysZ:

  • Perform competition assays in the proteoliposome system using radiolabeled sulfate and excess unlabeled potential competitors (selenate, thiosulfate, phosphate, etc.)

  • Determine IC50 values for each competing anion

  • Assess direct transport of alternative anions if radiolabeled versions are available

This approach would determine whether P. multocida CysZ is strictly a sulfate transporter or if it can accommodate other anions, providing insights into the molecular basis of substrate recognition.

Which conserved residues are critical for P. multocida CysZ function?

Based on structural data from other CysZ proteins, several conserved motifs and residues likely play crucial roles in P. multocida CysZ function:

  • The ExVE motif: Contains acidic residues that form salt bridges with conserved basic residues

  • The QYxDYPxDNHK motif: Forms part of the intricate network of interactions in the hydrophilic head

  • Conserved arginines (equivalent to R129 and R133 in P. denitrificans CysZ) that interact with acidic residues

  • Conserved tyrosine (equivalent to Y177 in P. denitrificans CysZ) located below the membrane interface

A systematic alanine-scanning mutagenesis approach focusing on these conserved residues would be valuable for identifying those critical for sulfate transport activity.

How do the structural differences between CysZ homologs affect their function?

While CysZ proteins share considerable structural similarity, subtle differences may affect their function or regulation. To investigate this for P. multocida CysZ:

  • Create a detailed sequence alignment with structurally characterized CysZ proteins

  • Identify P. multocida-specific residues, particularly those lining potential transport pathways

  • Use homology modeling based on existing structures to predict P. multocida CysZ structure

  • Design chimeric proteins to test functional differences between domains of different CysZ homologs

The comparison of CysZ structures from I. loihiensis, P. fragi, and P. denitrificans revealed flexibility in the positioning of helices H4-H5, which might have functional implications .

What crystallization approaches have been successful for CysZ proteins?

Structural studies of CysZ proteins have employed several successful crystallization strategies that could be adapted for P. multocida CysZ:

  • Screening multiple homologs: A structural genomics approach tested 63 bacterial homologs to identify those suitable for crystallization

  • Testing multiple detergents and crystal forms: CysZ from P. denitrificans crystallized in multiple forms belonging to space groups P63, P4122, and P21

  • Phase determination strategies:

    • Single-wavelength anomalous dispersion (SAD) based on selenate ions

    • Selenomethionine derivatization

    • Multi-crystal native SAD

The highest resolution achieved for CysZ structures was 2.3 Å for I. loihiensis CysZ , providing a benchmark for P. multocida CysZ structural studies.

How can I identify potential sulfate binding sites in P. multocida CysZ?

To identify sulfate binding sites in P. multocida CysZ:

  • Co-crystallization with sulfate or selenate (a sulfate analog)

  • Soaking crystals in sulfate-containing solution

  • Performing isothermal titration calorimetry (ITC) with sulfate and purified protein

  • Molecular docking simulations based on homology models

  • Mutational analysis of predicted binding site residues combined with functional assays

The I. loihiensis CysZ structure was initially solved using a single selenate ion bound to the protein , suggesting this approach might be applicable to P. multocida CysZ as well.

How does P. multocida CysZ relate evolutionarily to other bacterial sulfate transporters?

CysZ represents a unique class of sulfate transporters distinct from other known membrane transporters or ion channels . To place P. multocida CysZ in evolutionary context:

  • Perform phylogenetic analysis of CysZ sequences across diverse bacterial species

  • Compare with other known sulfate transporter families (SulT, SLC26)

  • Analyze gene neighborhoods to identify conserved genomic context

  • Assess horizontal gene transfer events that might have shaped CysZ distribution

What is the relationship between CysZ and other proteins involved in the sulfate assimilation pathway in P. multocida?

Understanding the broader context of sulfate metabolism in P. multocida requires analysis of:

  • The organization of the cys operon in P. multocida compared to other bacteria

  • Protein-protein interactions between CysZ and other components of the sulfate assimilation pathway

  • Transcriptional regulation of cysZ in response to sulfate availability

  • Potential coordinate regulation with capsular polysaccharide biosynthesis genes

P. multocida has complex capsular polysaccharide biosynthesis systems with five capsular serogroups (A, B, D, E, and F) , and understanding how sulfate transport via CysZ might relate to these pathways could provide insights into bacterial physiology and virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.