Recombinant Pasteurella multocida Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for the specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secG; PM0208; Protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
secG
Target Protein Sequence
MYQTLLLGYAIIAIVIVFLILIQQGKGADAGASFGGGASGTIFGSVGSGNFLSKMTALLA TAFFVMSIVIGNVNSHRNNVKQGKFDDLSATAEQIQQQQKIDAPAVETKNSDIPQ
Uniprot No.

Target Background

Function
SecG is involved in protein export and participates in an early event of protein translocation.
Database Links

KEGG: pmu:PM0208

STRING: 272843.PM0208

Protein Families
SecG family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the SecG protein in Pasteurella multocida and what is its functional role?

SecG is a component of the SecYEG heterotrimer, which forms the protein translocation channel in the bacterial inner membrane. In P. multocida, as in other gram-negative bacteria, this complex is crucial for exporting proteins across the cytoplasmic membrane to the periplasmic space. While SecY and SecE are essential genes, SecG is not essential for growth under standard laboratory conditions .

The protein-export membrane protein SecG in P. multocida functions as part of the bacterial secretion machinery. Based on studies in model organisms, SecG appears to facilitate the insertion and function of SecA, the ATPase that provides energy for translocation. SecG helps in the critical opening step of translocation (plug displacement), which becomes especially important when dealing with less efficient signal sequences .

How conserved is P. multocida SecG compared to other bacterial species?

P. multocida SecG shares functional similarities with SecG proteins from other gram-negative bacteria, particularly in its role within the SecYEG complex. Comparative studies have shown that while the essentiality of SecG varies across bacterial species, its function in enhancing protein translocation efficiency remains relatively conserved.

When examining SecG function across different bacteria, research in E. coli serves as a valuable model. E. coli SecG has been shown to enhance protein export, particularly with mutant or inefficient signal sequences . The protein appears to modulate the SecA insertion cycle in ways that differ from other accessory components like SecDFyajC, both in extent and timing during the translocation process .

A compelling evolutionary hypothesis suggests that SecG has been maintained during evolution specifically to assist in circumstances where signal sequences are weak or suboptimal, providing a critical backup mechanism for protein export .

What experimental approaches are most effective for studying P. multocida SecG function?

Researchers have several established methodologies for investigating SecG function that can be applied to P. multocida studies:

  • Quantitative Export Assays: Sensitive assays measuring protein translocation kinetics with and without SecG provide crucial insights into its functional contribution. These allow comparison between wild-type and mutant signal sequence export efficiency .

  • In vitro Translocation Systems: Reconstituted systems using purified components or inverted membrane vesicles (IMVs) allow direct measurement of SecG's stimulatory effect on protein export. This approach has revealed that SecG has a more pronounced effect in vitro than observed in vivo under standard conditions .

  • Genetic Approaches:

    • Construction of secG deletion mutants

    • Creation of secG/prlA double mutants to study epistatic interactions

    • Analysis of suppressor mutations that rescue defects in protein export

  • Biochemical Stability Assays: Examining the stability of the SecYE dimer in solubilized membranes with and without SecG provides insights into its structural contribution to the translocase complex .

What is known about the specific characteristics of recombinant P. multocida SecG protein?

Recombinant P. multocida SecG protein (specifically aa 1-115) has been successfully expressed in various systems including E. coli, yeast, baculovirus, and mammalian cells . The protein serves as an important research tool and potential vaccine component.

When expressing recombinant P. multocida SecG, researchers should consider:

  • Expression System Selection: The choice between prokaryotic (E. coli) and eukaryotic (yeast, baculovirus, mammalian) systems depends on research goals and downstream applications .

  • Protein Characteristics: The 115 amino acid fragment (aa 1-115) represents a functional domain for research applications. Complete characterization should include verification of proper folding and membrane insertion capability .

  • Storage Conditions: Proper storage is essential for maintaining protein stability and functionality for experimental use .

How does SecG contribute to the mechanism of protein translocation in P. multocida?

SecG plays a sophisticated role in the protein translocation process that extends beyond being a simple structural component of the SecYEG complex. Based on detailed mechanistic studies, we can outline its probable functions in P. multocida:

What is the relationship between P. multocida SecG and antibiotic resistance?

While SecG itself is not directly linked to antibiotic resistance in P. multocida, understanding the secretory pathway has important implications for antimicrobial development. P. multocida exhibits varying antibiotic resistance patterns that are primarily related to its plasmid genomes rather than SecG function directly:

How can researchers distinguish between the functions of P. multocida SecG and other Sec translocase components?

Distinguishing the specific contributions of SecG from other Sec translocase components requires sophisticated experimental approaches:

  • Comparative Analysis of Single and Double Mutants:

    • Construction of secG deletion mutants alongside mutations in other sec genes

    • Analysis of epistatic effects between secG and prlA (secY) mutations

    • Quantitative assessment of protein export in various mutant backgrounds

  • Biochemical Dissection:

    • Reconstituted systems with defined component compositions

    • Analysis of SecA membrane insertion with various combinations of Sec components

    • Assessment of SecYE dimer stability in the presence or absence of SecG

  • Distinctive SecG Effects:

    • SecG and SecDFyajC modulate SecA insertion in different ways

    • SecDFyajC prevents SecA de-insertion (requiring ATP hydrolysis) and increases SecA insertion (involving only nucleotide binding)

    • SecG primarily enhances SecA insertion after initiation of translocation

ComponentEffect on SecA InsertionTiming of EffectMagnitude
SecGIncreases efficiency of SecA insertion at SecYEPrimarily after initiation of translocation~12-fold increase
SecDFyajCIncreases efficiency of SecA insertion at SecYE and prevents de-insertionThroughout translocation process~3-fold increase
SecYE aloneProvides binding and insertion sites for SecABaseline activityReference level

What are the implications of P. multocida SecG research for vaccine development?

Recombinant P. multocida proteins, including SecG, represent potential vaccine candidates for preventing diseases caused by this pathogen:

  • Vaccine Target Potential: As a membrane protein involved in essential cellular processes, SecG presents a potential target for vaccine development. Recombinant SecG protein (aa 1-115) is being investigated for its immunogenic properties .

  • Host Range Considerations: P. multocida causes various diseases across different animal species, including fowl cholera in poultry, atrophic rhinitis in pigs, and bovine hemorrhagic septicemia in cattle and buffalo. It can also cause zoonotic infections in humans from pet bites or scratches . This wide host range necessitates careful vaccine design consideration.

  • Strain Variation: P. multocida is classified into five serogroups (A, B, D, E, F) based on capsular composition and 16 somatic serovars (1-16) . Vaccine development must account for this strain diversity and target conserved epitopes in SecG.

  • Experimental Approaches:

    • Expression of recombinant P. multocida SecG in various systems

    • Immunogenicity testing in animal models

    • Challenge studies to assess protective efficacy

    • Comparison with other P. multocida antigens to optimize vaccine formulation

What expression systems are optimal for producing recombinant P. multocida SecG?

Different expression systems offer distinct advantages for producing recombinant P. multocida SecG, depending on research objectives:

  • E. coli Expression System:

    • Advantages: High yield, cost-effective, rapid production

    • Considerations: Potential issues with proper folding of membrane proteins, may require optimization of growth conditions and extraction protocols

    • Best for: Initial characterization studies, structural analysis requiring large quantities

  • Yeast Expression System:

    • Advantages: Eukaryotic post-translational modifications, better folding environment for complex proteins

    • Considerations: Lower yield than E. coli, longer production time

    • Best for: Functional studies requiring properly folded protein

  • Baculovirus Expression System:

    • Advantages: High expression levels, suitable for membrane proteins, proper folding

    • Considerations: More complex setup, higher cost than bacterial systems

    • Best for: Functional studies, vaccine development applications

  • Mammalian Cell Expression:

    • Advantages: Most sophisticated folding machinery, closest to native conditions

    • Considerations: Highest cost, most complex, lowest yields

    • Best for: Studies focusing on host-pathogen interactions, immunological studies

What purification challenges are specific to P. multocida SecG, and how can they be addressed?

Purifying membrane proteins like SecG presents specific challenges that require tailored approaches:

  • Membrane Extraction:

    • Challenge: Efficiently extracting SecG from membranes without denaturing

    • Solution: Optimization of detergent type and concentration (e.g., n-dodecyl-β-D-maltopyranoside, digitonin, or CHAPS)

    • Validation: Functional assays to confirm protein activity after extraction

  • Maintaining Stability:

    • Challenge: Preventing aggregation and maintaining native conformation

    • Solution: Addition of stabilizers like glycerol (10-15%) and appropriate pH buffering

    • Validation: Size exclusion chromatography to assess monodispersity

  • Purification Strategy:

    • Primary: Affinity chromatography using His-tag or other fusion tags

    • Secondary: Ion exchange chromatography for higher purity

    • Final: Size exclusion chromatography for homogeneity assessment and buffer exchange

  • Quality Control:

    • Activity assays: In vitro protein translocation assays using reconstituted systems

    • Structural integrity: Circular dichroism spectroscopy to assess secondary structure

    • Purity assessment: SDS-PAGE and Western blotting

How can researchers design definitive experiments to elucidate P. multocida SecG function?

To comprehensively characterize P. multocida SecG function, researchers should consider these experimental approaches:

  • Genetic Manipulation Studies:

    • Construction of secG deletion strains in P. multocida

    • Complementation studies with wild-type and mutant secG alleles

    • Assessment of phenotypic changes in protein export, growth rates, and stress response

    • Epistatic analysis with mutations in other components of the Sec pathway

  • Biochemical Characterization:

    • Reconstitution of P. multocida SecYEG in proteoliposomes

    • ATP-driven and AMP-PNP-driven SecA insertion assays

    • Quantitative analysis of wild-type and mutant signal sequence translocation

    • Assessment of SecYE dimer stability with and without SecG

  • Structural Studies:

    • Cryo-EM analysis of the P. multocida SecYEG complex

    • Crosslinking studies to map interaction interfaces with SecA and translocating peptides

    • Molecular dynamics simulations to understand conformational changes during translocation

  • Comparative Analysis:

    • Functional complementation studies using secG from different bacterial species

    • Analysis of species-specific differences in SecG contribution to protein export

    • Correlation with host range and pathogenicity

What controls are essential when studying P. multocida SecG in heterologous systems?

When studying P. multocida SecG in heterologous systems, proper controls are critical for data interpretation:

  • Positive Controls:

    • Well-characterized homologous protein (e.g., E. coli SecG) to validate assay functionality

    • Wild-type P. multocida SecG as a reference for mutational studies

    • Known SecG-dependent substrate proteins to demonstrate functional activity

  • Negative Controls:

    • Empty vector controls for expression studies

    • Inactive SecG mutants (based on literature or rational design)

    • Non-secretory control proteins to demonstrate specificity

  • System-Specific Controls:

    • Assessment of expression system's endogenous Sec machinery contribution

    • Verification that heterologous SecG properly integrates into the host's SecYE complex

    • Quantification of background translocation activity in the absence of SecG

  • Validation Approaches:

    • Multiple experimental systems to confirm findings (in vivo and in vitro)

    • Different detection methods for protein translocation

    • Genetic and biochemical approaches to cross-validate results

How should researchers interpret differences in SecG activity across experimental systems?

Variations in SecG activity across different experimental systems require careful interpretation:

  • System-Dependent Variables:

    • In vitro translocation assays often show more pronounced SecG effects than in vivo experiments

    • The magnitude of SecG contribution varies depending on the specific signal sequences studied

    • Reconstituted systems may lack regulatory factors present in intact cells

  • Reconciling Contradictory Data:

    • Consider time scales of different assays (seconds for pulse-chase experiments vs. hours for colony growth)

    • Evaluate the sensitivity of detection methods used

    • Assess whether differences reflect biological reality or technical limitations

  • Analytical Framework:

    • Quantitative comparison across systems using standardized substrates

    • Statistical analysis to determine significance of observed differences

    • Development of mathematical models to account for system-specific variables

  • Experimental Recommendations:

    • Use multiple complementary approaches to study SecG function

    • Include both wild-type and mutant signal sequences in functional assays

    • Carefully document experimental conditions that may influence outcomes

What approaches can resolve contradictory data regarding P. multocida SecG function?

When faced with contradictory data on SecG function, researchers should implement these resolution strategies:

  • Systematic Variable Isolation:

    • Standardize protein expression levels across experiments

    • Control for membrane composition differences between systems

    • Evaluate temperature, pH, and ionic strength effects on SecG activity

  • Advanced Analytical Approaches:

    • Single-molecule techniques to directly observe SecG dynamics

    • Time-resolved studies to capture transient states during translocation

    • High-resolution structural analysis of SecG in different functional states

  • Integration of Multiple Datasets:

    • Meta-analysis of published SecG functional data

    • Development of computational models that can account for experimental variables

    • Collaborative cross-laboratory validation studies

  • Biological Context Consideration:

    • Evaluation of growth conditions that might alter SecG importance

    • Assessment of stress conditions that may reveal conditional phenotypes

    • Investigation of host-specific factors that influence SecG function

What emerging techniques might advance understanding of P. multocida SecG dynamics?

Several cutting-edge approaches show promise for elucidating SecG function in greater detail:

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize SecG localization and dynamics in living cells

    • Single-particle cryo-EM to resolve structural transitions during the translocation cycle

    • FRET-based approaches to monitor conformational changes in real-time

  • Systems Biology Approaches:

    • Proteome-wide analysis of SecG-dependent and independent protein export

    • Integration of transcriptomics and proteomics to map SecG's role in stress responses

    • Network analysis to position SecG within the broader protein secretion machinery

  • Synthetic Biology Tools:

    • Designer signal sequences to probe SecG's sequence-specific contributions

    • Engineered SecG variants with enhanced or altered functionality

    • Minimal reconstituted systems to define the essential components for SecG function

  • Computational Approaches:

    • Molecular dynamics simulations of the complete SecYEG-SecA-preprotein complex

    • Machine learning algorithms to predict SecG-dependent export substrates

    • Evolutionary analysis to understand SecG conservation and specialization

How might targeting SecG contribute to novel antimicrobial strategies against P. multocida?

The essential nature of protein secretion presents potential antimicrobial opportunities:

  • SecG as an Antibiotic Target:

    • While SecG is not essential under laboratory conditions, its importance increases under stress and with suboptimal signal sequences

    • Compounds that interfere with SecG function could synergize with other stresses or antibiotics

    • Species-specific targeting might be possible by exploiting unique features of P. multocida SecG

  • Combination Therapy Approaches:

    • SecG inhibitors combined with signal peptide mimetics

    • Targeting multiple components of the Sec pathway simultaneously

    • Exploiting SecG's role in stress response to enhance conventional antibiotic efficacy

  • Experimental Approaches for Drug Discovery:

    • High-throughput screens for SecG inhibitors using reconstituted translocation assays

    • Structure-based drug design targeting SecG-SecA or SecG-SecY interfaces

    • Phenotypic screens under conditions where SecG becomes more critical

  • Alternative Strategies:

    • Attenuated strains with modified SecG for live vaccine development

    • Immunotherapeutic approaches targeting exposed SecG epitopes

    • CRISPR-based antimicrobials targeting secG regulatory elements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.