Recombinant Pasteurella multocida Putative zinc metalloprotease PM1991 (PM1991)

What is Pasteurella multocida PM1991 and what is its significance in microbial research?

Pasteurella multocida PM1991 is a putative zinc metalloprotease protein identified in the bacterium Pasteurella multocida. It has significance in microbial research as part of the broader study of bacterial virulence factors and gene expression patterns. The protein consists of 442 amino acids (full length) and contains characteristic domains of zinc metalloproteases . P. multocida is recognized as a pathogen responsible for multiple diseases in avian and mammalian hosts, making its virulence factors important subjects for understanding bacterial pathogenesis . Research into PM1991 contributes to our understanding of bacterial protein expression, structure-function relationships, and potential roles in bacterial adaptation to host environments.

What structural and functional characteristics define PM1991?

PM1991 is characterized by a 442-amino acid sequence with specific structural features that classify it as a putative zinc metalloprotease. The full amino acid sequence is:

MSFLWSFASFIIVISVLVAVHEYGHFWAARKCGIQVHRFSIGFGKVLWSRTDKQGTEFVISAIPLGGYVKMLDGRNEVVPPELSSRAFDQKSVLQRAFVIAAGPIANFLFAILAYFTIYTGIPTVKPVIADISSNSIAAQAQIEPNTQIMAVDGTKVSDWETINMLLATKMGNDEIHLTLSPFGSSIEQHKVLNTKDWRFDPEKESAMSSLGLQPVRTKVDMILSKVEVNSPADKAGLKAGDRIYAGEQLISWQQFVQFVQEGKPFNVKVERDGQFSFVVLTPELNKKGRWYVGIAPTAAPISDIYRTELKYGILEALQKGVEKTIQLSWLTIKVIGKLFTGDLALKNLGGPISIAKGAGISSEIGLIYYLGFMALISVNLGIMNLFPLPVLDGGHLVFLAAEAVRGKPLSERIQNLSYRIGAAILMALMGFALFNDFLRL

Functionally, as a putative zinc metalloprotease, PM1991 likely plays a role in protein degradation processes that may contribute to bacterial survival, adaptation, or virulence. The protein contains domains typical of zinc metalloproteases, which utilize zinc ions in their catalytic sites to hydrolyze peptide bonds in target proteins. This enzymatic activity could be involved in nutrient acquisition, immune evasion, or tissue invasion during infection.

How does PM1991 expression change under different environmental conditions?

While the search results don't specifically detail PM1991's expression patterns under different conditions, studies on P. multocida gene expression provide relevant insights. Under iron-limiting conditions, P. multocida generally shows decreased expression (2.1- to 6-fold) of genes involved in energy metabolism and electron transport, while genes involved in iron binding and transport show increased expression (2.1- to 7.7-fold) .

As a putative zinc metalloprotease, PM1991 may show altered expression patterns under metal-limited conditions, particularly zinc limitation, similar to the iron response patterns observed in other P. multocida genes. The specific response of PM1991 to environmental stressors would require targeted gene expression analysis through methods such as RT-PCR, microarray analysis, or RNA sequencing under controlled experimental conditions.

What are the theoretical mechanisms by which PM1991 might contribute to P. multocida pathogenesis?

As a putative zinc metalloprotease, PM1991 may contribute to P. multocida pathogenesis through several potential mechanisms:

• Extracellular matrix degradation: PM1991 might degrade host tissue components, facilitating bacterial invasion and dissemination.

• Immune evasion: The protease activity could target host immune molecules, such as antibodies or complement factors, helping the bacterium evade host defenses.

• Nutrient acquisition: PM1991 may break down host proteins into peptides and amino acids that can be utilized by the bacterium as nutritional sources, particularly important during infection when nutrients may be limited.

• Biofilm formation: Metalloproteases can contribute to biofilm development and maintenance, potentially enhancing bacterial persistence.

• Activation of host proteases: PM1991 might activate host metalloproteinases, indirectly contributing to tissue damage and bacterial spread.

These mechanisms would need experimental validation through methods such as gene knockout studies, recombinant protein activity assays, and in vivo infection models to determine the actual contribution of PM1991 to virulence.

How might PM1991 interact with host metalloproteinase systems during infection?

PM1991, as a bacterial metalloprotease, could potentially interact with host metalloproteinase systems in several sophisticated ways:

• Competitive inhibition: PM1991 might compete with host metalloproteases for similar substrates, altering the normal function of host enzyme systems.

• Activation of host zymogens: Like some bacterial proteases, PM1991 could potentially activate host matrix metalloproteinase (MMP) zymogens, indirectly promoting tissue degradation without direct bacterial action.

• Degradation of host MMP inhibitors: PM1991 might target tissue inhibitors of metalloproteinases (TIMPs), the natural regulators of host MMPs, resulting in dysregulated MMP activity and tissue damage.

• Molecular mimicry: PM1991 could structurally mimic host metalloproteases, potentially interfering with signaling pathways or protein-protein interactions.

Research into these interactions would require co-culture experiments, purified protein interaction studies, and detailed structural analyses to elucidate the specific molecular mechanisms at play.

What role might PM1991 play in bacterial response to iron limitation compared to other P. multocida virulence factors?

Iron limitation is a significant stress factor for bacterial pathogens during infection, as hosts sequester iron as a defense mechanism. While the specific role of PM1991 under iron limitation isn't detailed in the search results, we can draw parallels with general P. multocida responses:

P. multocida shows significant transcriptional adaptations under iron-limited conditions, with genes involved in iron binding and transport increasing 2.1- to 7.7-fold, while genes for energy metabolism and electron transport decrease 2.1- to 6-fold . Whether PM1991 follows these patterns remains to be experimentally determined.

As a metalloprotease requiring zinc rather than iron, PM1991 might be differentially regulated compared to iron-dependent virulence factors. Potential hypotheses include:

• Compensatory expression: If iron-dependent proteases are downregulated under iron limitation, PM1991 might be upregulated to compensate for lost proteolytic capacity.

• Nutritional adaptation: PM1991 could be upregulated to increase protein degradation, providing alternative nutrient sources when iron-dependent metabolic pathways are compromised.

• Zinc homeostasis: Under iron limitation, bacteria may alter zinc utilization patterns, potentially affecting PM1991 expression and activity.

Comparative transcriptomic and proteomic studies specifically examining PM1991 alongside known iron-regulated virulence factors would be necessary to elucidate these relationships.

What are the optimal conditions for the expression and purification of recombinant PM1991?

Based on the available information, the optimal conditions for expression and purification of recombinant PM1991 include:

• Expression system: E. coli has been successfully used for the expression of recombinant PM1991 .

• Tag system: His-tagging has been employed, specifically with an N-terminal His tag fused to the full-length protein (amino acids 1-442) .

• Storage conditions:

  • Long-term storage: -20°C/-80°C

  • Working aliquots: 4°C for up to one week

  • Repeated freeze-thaw cycles should be avoided

• Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

• Reconstitution protocol:

  • Centrifuge vial briefly before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% is recommended)

  • Aliquot for long-term storage

For optimal expression, researchers should consider:

• Induction conditions (IPTG concentration, temperature, duration)

• Cell lysis methods that preserve enzyme activity

• Purification strategies that maintain the native conformation of the zinc-binding site

What analytical techniques are most appropriate for assessing PM1991 enzymatic activity?

To rigorously assess the enzymatic activity of PM1991 as a zinc metalloprotease, multiple complementary techniques should be employed:

• Fluorogenic peptide substrate assays: Using synthetic peptides with quenched fluorophores that emit fluorescence upon cleavage. This allows for real-time monitoring of proteolytic activity and kinetic measurements.

• Zymography: In-gel activity assays using substrate-impregnated gels (such as casein or gelatin) to visualize zones of proteolytic activity. This technique can also confirm the molecular weight of the active enzyme.

• HPLC-based peptide cleavage analysis: Analyzing the cleavage products of defined peptide substrates to determine sequence specificity of PM1991.

• Active site titration: Using specific metalloprotease inhibitors like EDTA, 1,10-phenanthroline, or hydroxamates to quantify active enzyme concentration.

• Metal dependency analysis: Assessing activity in the presence of different divalent metal ions (Zn²⁺, Ca²⁺, Mg²⁺, etc.) and metal chelators to confirm zinc dependency.

• pH and temperature profiling: Determining optimal conditions for enzymatic activity by measuring activity across pH and temperature ranges.

Data from these assays should be statistically analyzed to determine parameters such as kcat, Km, and substrate preferences, providing insights into the catalytic efficiency and specificity of PM1991.

How can researchers effectively design gene knockout studies to evaluate PM1991 function in P. multocida?

Designing effective gene knockout studies for PM1991 requires careful planning and multiple control measures:

• Knockout strategy selection:

  • Allelic exchange mutagenesis

  • Insertional inactivation

  • CRISPR-Cas9 based genome editing

• Essential verification steps:

  • PCR confirmation of gene deletion

  • Whole-genome sequencing to verify no off-target effects

  • Transcriptomic analysis to confirm no polar effects on adjacent genes

  • Complementation studies to restore the wild-type phenotype

• Phenotypic characterization:

  • Growth curve analysis under various conditions

  • Protease activity assays

  • Biofilm formation assessment

  • Cellular morphology examination

  • Stress response testing (oxidative, thermal, acid, etc.)

  • Virulence assessment in appropriate infection models

• Comparative design elements:

  • Include wild-type controls

  • Consider constructing knockouts of related metalloproteases for comparison

  • Test under multiple environmental conditions, particularly zinc and iron limitation

• Complementation approaches:

  • Plasmid-based expression

  • Chromosomal reintegration

  • Controlled expression systems (inducible promoters)

For data analysis, researchers should employ statistical methods appropriate for the specific assays, including ANOVA for multiple condition comparisons and survival analysis methods for infection model data.

How should researchers interpret contradictory results between in vitro and in vivo studies of PM1991 function?

When encountering contradictions between in vitro and in vivo results for PM1991 function, researchers should implement a systematic analysis approach:

• Evaluate methodological differences:

  • Purified protein vs. whole bacteria studies

  • Buffer conditions vs. physiological environments

  • Substrate concentrations and accessibility

  • Presence of host factors in vivo that are absent in vitro

• Consider regulatory factors:

  • In vivo expression levels may differ from in vitro conditions

  • Host-induced changes in bacterial gene expression

  • Post-translational modifications present only in the host environment

• Examine technical limitations:

  • Detection sensitivity differences between methods

  • Sampling timepoints and their relevance to infection stages

  • Potential artifacts from experimental manipulations

• Resolution strategies:

  • Develop ex vivo models that bridge the gap between in vitro and in vivo systems

  • Use tissue culture systems with relevant host cells

  • Employ real-time monitoring of gene expression during infection

  • Utilize conditional expression systems to control PM1991 expression at specific infection stages

• Data integration approach:

  • Weigh evidence based on methodological strength

  • Develop working models that accommodate both sets of observations

  • Design experiments specifically to address the contradictions

Ultimately, contradictions often reveal important biological complexities rather than experimental failures, and may lead to discovery of context-dependent functions of PM1991.

What bioinformatic approaches can identify potential substrates for PM1991 in host tissues?

Identifying potential substrates for PM1991 requires sophisticated bioinformatic approaches combined with validation experiments:

• Sequence-based prediction methods:

  • Analyze known metalloprotease cleavage sites to develop prediction algorithms

  • Scan host proteomes for similar motifs

  • Use machine learning approaches trained on known metalloprotease substrates

• Structural bioinformatics:

  • Homology modeling of PM1991 based on related metalloproteases

  • Molecular docking with potential substrate proteins

  • Molecular dynamics simulations of enzyme-substrate interactions

• Systems biology approaches:

  • Network analysis to identify host proteins in pathways affected during infection

  • Expression correlation analyses between PM1991 and host response proteins

  • Pathway enrichment analysis of proteomics data from infection models

• Comparative genomics and evolutionary analysis:

  • Compare PM1991 with metalloproteases from related pathogens

  • Analyze conservation patterns in substrate binding regions

  • Identify positively selected sites that may indicate host-pathogen co-evolution

• Validation experimental design:

  • High-throughput substrate screening using peptide libraries

  • Proteomics analysis of cleaved products in host-pathogen interaction models

  • TAILS (Terminal Amine Isotopic Labeling of Substrates) or other N-terminomics approaches

These approaches should be iterative, with bioinformatic predictions guiding experimental validation, and experimental results refining bioinformatic models.

How can researchers distinguish between direct effects of PM1991 and indirect consequences of its activity in complex experimental systems?

Distinguishing direct from indirect effects of PM1991 activity requires carefully designed experiments and controls:

• Enzyme activity modulation approaches:

  • Use of catalytic site mutants that maintain structural integrity but lack enzymatic activity

  • Dose-dependent addition of specific inhibitors

  • Inducible expression systems to control timing of PM1991 activity

• Temporal analysis strategies:

  • Time course experiments to establish sequence of events

  • Pulse-chase experimental designs

  • Real-time monitoring using reporter systems or live imaging

• Spatial localization techniques:

  • Subcellular fractionation to determine compartmentalization of effects

  • Immunofluorescence microscopy to colocalize PM1991 with affected molecules

  • Proximity labeling approaches (BioID, APEX) to identify proteins in direct contact with PM1991

• Biochemical validation methods:

  • In vitro cleavage assays with purified components

  • Pull-down experiments to identify direct binding partners

  • Surface plasmon resonance or other interaction analyses to measure direct binding

• Control experimental systems:

  • Parallel studies with related but distinct metalloproteases

  • Complementation with heterologous metalloproteases of known specificity

  • Reconstitution experiments adding components sequentially

• Data analysis approaches:

  • Network analysis to map direct interactions versus downstream effects

  • Mathematical modeling of reaction kinetics

  • Principal component analysis to separate primary and secondary effects

These approaches collectively provide multiple lines of evidence to differentiate direct enzymatic activities from downstream signaling or compensatory responses.

What approaches should be considered when evaluating PM1991 as a potential therapeutic target?

When evaluating PM1991 as a therapeutic target, researchers should implement a comprehensive assessment strategy:

• Target validation criteria:

  • Evidence from gene knockout studies demonstrating attenuated virulence

  • Confirmation of enzyme activity contribution to pathogenesis

  • Conservation across clinically relevant strains

  • Absence of functional redundancy with other bacterial proteases

• Druggability assessment:

  • Structural analysis of the active site

  • Identification of unique features distinguishing PM1991 from host metalloproteases

  • Assessment of accessibility to inhibitors in the bacterial context

• Inhibitor discovery approaches:

  • Structure-based virtual screening

  • Fragment-based drug design

  • High-throughput screening of chemical libraries

  • Repurposing of existing metalloprotease inhibitors

• Therapeutic modality considerations:

  • Small molecule inhibitors

  • Peptide-based inhibitors

  • Monoclonal antibodies against PM1991

  • Vaccine approaches targeting PM1991

• Translational challenges to address:

  • Delivery to infection sites

  • Selectivity over host metalloproteases

  • Resistance development potential

  • Pharmacokinetic properties in relevant animal models

The exceptional potential of PM1991 as a therapeutic target may lie in its role within bacterial adaptation mechanisms, particularly if it proves essential for survival under stress conditions encountered during infection .

How might PM1991 be incorporated into nanocapsule-based drug delivery systems?

Building on research in metalloprotease-responsive drug delivery systems, PM1991 could be utilized in nanocapsule designs through several innovative approaches:

• PM1991 as a targeting enzyme:

  • Similar to the nanocapsule-based prodrug systems that utilize metalloproteinase-2 (MMP-2) for targeted release in tumor microenvironments , engineered substrates specifically cleaved by PM1991 could be incorporated into nanocapsule designs.

  • These would enable bacterial presence-triggered drug release in infection sites where PM1991 is expressed.

• PM1991-specific peptide crosslinkers:

  • Custom peptide crosslinkers with sequences recognized by PM1991 could be designed for nanocapsule stabilization.

  • When these nanocapsules encounter P. multocida expressing PM1991, the crosslinkers would be cleaved, releasing encapsulated antimicrobial agents directly at the infection site .

• PM1991 encapsulation for vaccine development:

  • Recombinant PM1991 itself could be encapsulated within polymer shells formed by in situ polymerization.

  • This approach could protect the antigen from degradation and enhance its immunogenicity when used in vaccine formulations.

• Technical considerations for implementation:

  • Optimization of the MPC/protein ratio for effective encapsulation (based on the 12000:1 ratio used in similar systems)

  • Selection of appropriate polymer shell components compatible with PM1991 activity

  • Stability testing under physiological conditions

  • Release kinetics studies in the presence of P. multocida cultures

These approaches would require extensive validation through in vitro and in vivo models to confirm specificity, efficacy, and safety before clinical translation.

What experimental designs would be most appropriate for evaluating species-specific variations in PM1991 across different Pasteurella strains?

To comprehensively evaluate species-specific variations in PM1991 across Pasteurella strains, researchers should implement a multi-layered experimental approach:

• Genomic comparative analysis:

  • Whole genome sequencing of multiple Pasteurella strains

  • Comparative genomics focusing on PM1991 genetic loci

  • Analysis of flanking regions for regulatory elements

  • Identification of single nucleotide polymorphisms and structural variations

• Transcriptomic profiling:

  • RNA-seq analysis under standardized conditions

  • Comparison of PM1991 expression levels across strains

  • Assessment of differential regulation under host-mimicking conditions

  • Identification of strain-specific transcriptional responses to stress

• Protein characterization:

  • Recombinant expression of PM1991 variants from different strains

  • Comparative enzymatic activity assays

  • Structural analysis using X-ray crystallography or cryo-EM

  • Thermal stability and pH optimum comparisons

• Host interaction studies:

  • Cross-species infection models

  • Competitive index assays with mixed strain infections

  • Analysis of PM1991 expression during in vivo infection

  • Host response comparisons to different PM1991 variants

• Evolutionary and phylogenetic analysis:

  • Construction of phylogenetic trees based on PM1991 sequences

  • Calculation of selection pressures on different protein domains

  • Identification of host-specific adaptive signatures

  • Molecular clock analysis to estimate divergence timing