Recombinant Pasteurella multocida Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Properties of Recombinant YedZ

PropertyDetail
Gene NameyedZ (Locus: PM0538)
Expression Region1–206
TagHis-tag (position determined during production)
Purity>85% (SDS-PAGE verified)
ApplicationsELISA, structural studies, enzymatic assays

Immunological Assays

The recombinant protein is commercially available for ELISA-based studies, enabling:

  • Quantification of antibody responses in infected hosts .

  • Epitope mapping for vaccine design .

Comparative Analysis with Other P. multocida Recombinant Proteins

While YedZ remains understudied, other P. multocida recombinant proteins (e.g., PlpE, OmpH, VacJ) have demonstrated utility in vaccine development and pathogenesis research:

Table 2: Contrasting Features of P. multocida Recombinant Proteins

ProteinMolecular WeightProtective EfficacyKey Function
YedZ~27–30 kDaNot yet reportedSulfoxide reduction
PlpE38 kDa83–100% in ducksOuter membrane lipoprotein
OmpH33.8 kDa80–100% in poultryPorin, immune evasion
PMT (toxin)146 kDaHigh cross-protectionInduces atrophic rhinitis in pigs

Data sources:

Challenges and Future Directions

  • Knowledge Gaps: Limited studies directly link YedZ to P. multocida virulence or host interactions.

  • Potential Applications:

    • Vaccine Adjuvant: Pairing YedZ with established antigens (e.g., PlpE or OmpH) to enhance immune coverage .

    • Diagnostic Marker: Exploring YedZ-specific antibodies in sera of infected animals .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
msrQ; PM0538; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
msrQ
Target Protein Sequence
MLSLFRIIIHVCCLGPVAWLAWVLLSGDESQLGADPIKEIQHFLGFSALTILLIMFILGK VFYLLKQPQLQVLRRALGLWAWFYVVLHVYAYLALELGYDFSLFVQELVNRGYLIIGAIA FLILTLMALSSWSYLKLKMGKWWFYLHQLGYYALLLGAIHYVWSVKNVTFSSMLYLILSI MILCDALYGLFIKRKGRSTSAHTGKD
Uniprot No.

Target Background

Function
Recombinant Pasteurella multocida Sulfoxide reductase heme-binding subunit YedZ (yedZ) is a component of the MsrPQ system, which repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) using respiratory chain electrons. This repair mechanism safeguards these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by the host's defense mechanisms. MsrPQ is crucial for maintaining envelope integrity under bleach stress and rescues a diverse range of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links

KEGG: pmu:PM0538

STRING: 272843.PM0538

Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida Sulfoxide reductase heme-binding subunit YedZ?

Pasteurella multocida Sulfoxide reductase heme-binding subunit YedZ (yedZ) is a membrane protein that functions as part of a sulfoxide reductase system. It is also known as Flavocytochrome YedZ and is encoded by the yedZ gene (locus tag PM0538 in strain Pm70). The protein consists of 206 amino acids in its full-length form and contains a heme-binding domain that is essential for its function in electron transfer processes . YedZ is involved in redox reactions, particularly in the reduction of sulfoxides, which can be important for bacterial survival under oxidative stress conditions.

How should recombinant YedZ protein be stored for optimal stability?

For optimal stability of recombinant YedZ protein, researchers should follow these evidence-based storage protocols:

  • Store the protein at -20°C for regular use.

  • For extended storage periods, maintain at either -20°C or -80°C.

  • Use a storage buffer containing Tris-based components with 50% glycerol, optimized specifically for this protein.

  • Avoid repeated freeze-thaw cycles, as these can degrade protein integrity and function.

  • For active experiments, working aliquots can be stored at 4°C for up to one week .

These storage conditions help maintain protein stability and biological activity by preventing denaturation and degradation processes.

What controls should be included when designing experiments with recombinant YedZ protein?

When designing experiments with recombinant YedZ protein, researchers should implement a comprehensive control strategy to ensure experimental validity:

Control TypePurposeImplementation
Negative ControlEstablish baseline and account for background effectsUse expression host cells (e.g., E. coli) without the target insert
Vehicle ControlControl for buffer effectsInclude samples with the storage buffer components minus the protein
Positive ControlValidate assay functionalityUse a well-characterized protein with similar function or commercial standards
Technical ReplicatesAssess measurement precisionMinimum of three replicates per experimental condition
Biological ReplicatesAccount for biological variabilityUse independent protein preparations from different expressions

Additionally, researchers should consider:

  • Including time-point controls to assess protein stability throughout the experiment

  • Testing for potential contaminants from the expression system

  • Validating protein activity using established biochemical assays before conducting main experiments

This control framework helps address potential sources of bias and increases the reliability of experimental results, following best practices recommended by the Experimental Design Assistant (EDA) .

How can researchers optimize blinding and randomization when conducting in vivo experiments with recombinant YedZ?

For in vivo experiments involving recombinant YedZ, implementing proper blinding and randomization is essential to reduce bias and improve reproducibility:

Randomization Protocol:

  • Identify all potential confounding variables (e.g., animal weight, age, cage location, time of day for procedures)

  • Design a stratified randomization scheme that accounts for these variables

  • Use the Experimental Design Assistant (EDA) to generate a randomization sequence that incorporates any blocking factors

  • Maintain detailed records of the randomization process for reporting

Blinding Implementation:

  • Assign coded identifiers to treatment groups that do not reveal group allocation

  • Ensure the researcher administering treatments is different from the one assessing outcomes

  • Maintain blinding during data collection and initial analysis phases

  • Implement a tiered-access system where key personnel maintain allocation codes until analysis is complete

When implementing these procedures, researchers should document all steps taken to maintain blinding and randomization integrity, as this information is increasingly required by journals and funding agencies. The EDA web-based tool can help researchers develop these protocols systematically while providing feedback on potential sources of bias in the experimental design .

What are the potential research applications of recombinant YedZ in studying Pasteurella multocida pathogenesis?

Recombinant YedZ offers several valuable applications in Pasteurella multocida pathogenesis research:

  • Host-Pathogen Interaction Studies: The protein can be used to investigate interactions with host cells, particularly in respiratory epithelial models, as P. multocida is a significant respiratory pathogen.

  • Vaccine Development: While YedZ itself hasn't been extensively studied as a vaccine component, the successful development of recombinant vaccines using other P. multocida proteins (like OMP36) suggests potential applications. The protective efficacy demonstrated in recombinant OMP36 vaccines, which showed 40-96% protection rates in poultry, provides a methodological framework for testing YedZ-based immunogens .

  • Oxidative Stress Response Mechanisms: As a sulfoxide reductase component, YedZ likely plays a role in bacterial responses to oxidative conditions within host environments. Researchers can use the recombinant protein to study these mechanisms through targeted knockout studies comparing wild-type and YedZ-deficient strains.

  • Serotype Cross-Protection Analysis: Similar to studies with OMP36, researchers can investigate whether antibodies raised against YedZ from one serotype provide cross-protection against heterologous serotypes, which is particularly relevant given the variable protection levels observed in recombinant vaccine studies (32-96% depending on serotype combinations) .

  • Diagnostic Development: The recombinant protein can be utilized to develop serological assays for detecting P. multocida infections, building on the IgG response patterns observed in immunization studies.

How can researchers accurately measure antibody responses to YedZ protein in immunization studies?

For accurate measurement of antibody responses to YedZ protein in immunization studies, researchers should implement the following methodological approach:

Sample Collection Protocol:

  • Collect serum samples at multiple timepoints: pre-immunization (baseline), 1 week post-primary immunization, 2 weeks post-primary (immediately before booster), and weekly thereafter for at least 4 weeks

  • Maintain consistent collection techniques and processing times across all samples

  • Store sera at -80°C with minimal freeze-thaw cycles to preserve antibody integrity

ELISA Methodology:

  • Develop a standardized ELISA using purified recombinant YedZ protein as the coating antigen

  • Establish a standard curve using reference sera with known antibody concentrations

  • Include technical triplicates for each biological sample

  • Incorporate both positive and negative control sera in each assay plate

  • Monitor antibody kinetics throughout the study period, as antibody levels typically increase after primary immunization, rise significantly following booster vaccination (week 2), peak around weeks 4-5, and may begin to decrease thereafter

Data Analysis:

  • Compare antibody responses across treatment groups using appropriate statistical tests (e.g., ANOVA with post-hoc comparisons)

  • Correlate antibody levels with protection outcomes in challenge studies

  • Analyze isotype distributions (IgG, IgM, IgA) to characterize the immune response profile

This approach aligns with successful methodologies employed in related recombinant protein immunization studies, where significant IgG increases were observed following immunization with recombinant proteins from P. multocida .

What are the potential functional differences between native and recombinant YedZ protein, and how might these impact experimental outcomes?

Several key factors can create functional differences between native and recombinant YedZ protein that may significantly impact experimental outcomes:

  • Post-translational modifications: Native YedZ may undergo specific modifications within P. multocida that are absent or different in recombinant expression systems. Researchers should validate whether critical modifications (such as heme incorporation) are properly maintained in the recombinant version.

  • Protein folding variations: Expression in heterologous systems (particularly E. coli) may result in subtle folding differences that affect activity. This is especially relevant for membrane proteins like YedZ, which may require specific membrane environments for proper folding.

  • Tag interference: Recombinant versions often include affinity tags that, while useful for purification, can interfere with protein function or interaction studies. Tag position (N- or C-terminal) should be carefully considered based on structural predictions for YedZ .

  • Expression system artifacts: Contaminants specific to the expression system may co-purify with the recombinant protein and affect experimental outcomes. Rigorous purification validation should be performed.

  • Membrane integration: As YedZ is a membrane protein, its functional properties depend on proper membrane integration, which may differ between native environments and recombinant systems.

To address these differences, researchers should:

  • Compare activity assays between native (when possible) and recombinant forms

  • Validate structural integrity using circular dichroism or other structural analysis methods

  • Consider using membrane mimetics for functional studies

  • Perform complementation studies in YedZ-knockout strains to confirm functional equivalence

These considerations are particularly important when using recombinant YedZ for vaccine development or functional studies, as evidenced by variable protection levels observed in related recombinant protein vaccine studies .

How can researchers effectively integrate YedZ protein studies into a comprehensive experimental approach to understand Pasteurella multocida virulence mechanisms?

To effectively integrate YedZ protein studies into a comprehensive approach for understanding P. multocida virulence mechanisms, researchers should implement a multi-level experimental framework:

Level 1: Molecular Characterization

  • Conduct detailed structure-function analyses of YedZ using site-directed mutagenesis to identify critical functional domains

  • Perform protein-protein interaction studies to map YedZ's role in sulfoxide reductase complexes

  • Investigate transcriptional regulation of yedZ under various environmental conditions relevant to host infection

Level 2: Cellular Integration

  • Develop YedZ knockout and complementation strains to assess phenotypic changes

  • Compare virulence factor expression profiles between wild-type and YedZ-mutant strains

  • Measure oxidative stress tolerance in various bacterial strains with modified YedZ expression

Level 3: Host-Pathogen Interface

  • Design infection models using relevant cell lines and animal models

  • Assess immune responses to wild-type versus YedZ-deficient P. multocida

  • Investigate whether anti-YedZ antibodies provide protection in challenge studies

Experimental Design Considerations:

  • Implement factorial designs to understand interactions between YedZ and other virulence factors

  • Utilize the Experimental Design Assistant (EDA) to develop rigorous protocols that minimize bias and maximize reproducibility

  • Balance in vitro mechanistic studies with in vivo relevance testing

Data Integration Strategy:

  • Use systems biology approaches to integrate transcriptomic, proteomic, and functional data

  • Develop testable models of YedZ's role in virulence networks

  • Compare findings across different P. multocida serotypes to identify conserved mechanisms

This comprehensive approach enables researchers to position YedZ studies within the broader context of P. multocida pathogenesis, similar to successful integrated approaches used for other bacterial virulence factors and recombinant vaccine studies .

What statistical approaches are most appropriate for analyzing complex datasets generated from YedZ immunization and challenge studies?

For complex datasets generated from YedZ immunization and challenge studies, researchers should implement sophisticated statistical approaches that account for the multifaceted nature of the data:

Survival Analysis Techniques:

  • Kaplan-Meier survival curves with log-rank tests to compare protection rates between vaccination groups

  • Cox proportional hazards models to identify factors influencing survival outcomes while controlling for covariates such as age, weight, and baseline antibody levels

  • Competing risk analysis when multiple failure types are possible (e.g., death from infection versus other causes)

Longitudinal Data Analysis:

  • Mixed-effects models for analyzing antibody response kinetics over time, accounting for both fixed effects (treatment group, dose) and random effects (individual animal variation)

  • Area under the curve (AUC) calculations for cumulative antibody responses followed by appropriate comparative tests

  • Repeated measures ANOVA with appropriate post-hoc testing for time-series data with multiple measurement points

Multivariate Approaches:

  • Principal component analysis or factor analysis to identify patterns in immune response variables

  • Path analysis to model relationships between immunization, antibody development, and protection outcomes

  • Structural equation modeling to test causal hypotheses about YedZ-induced protection mechanisms

Statistical Power Considerations:

  • A priori sample size calculations based on expected effect sizes from pilot studies

  • Post-hoc power analysis when interpreting negative results

  • Adjustment for multiple comparisons using methods appropriate to the research question (e.g., Bonferroni for conservative control, false discovery rate for exploratory analyses)

Reporting Standards:

These statistical approaches should be determined during the experimental design phase rather than after data collection, as recommended by the Experimental Design Assistant methodology , and should be aligned with the specific hypotheses being tested in YedZ studies.

What emerging technologies might enhance the study of YedZ protein function and its potential applications?

Several cutting-edge technologies show promise for advancing YedZ protein research:

  • Cryo-Electron Microscopy (Cryo-EM): This technique could reveal the detailed molecular structure of YedZ within membrane environments, providing insights into how the protein coordinates with other components of the sulfoxide reductase system. The structural data would inform rational design of YedZ variants with enhanced properties.

  • CRISPR-Cas9 Gene Editing: Precise genomic modifications in P. multocida could create targeted mutations in the yedZ gene to assess functional consequences. This approach would allow researchers to study the effects of specific amino acid substitutions in vivo without the confounding effects of complete gene knockout.

  • Single-Cell Transcriptomics: This technology could reveal heterogeneity in yedZ expression patterns within bacterial populations during infection, potentially identifying subpopulations with altered virulence profiles.

  • Advanced Protein Engineering Platforms: Directed evolution or computational design approaches could generate YedZ variants with improved stability or immunogenicity for vaccine development, building upon the recombinant vaccine approaches demonstrated with other P. multocida proteins .

  • Nanobody Development: Single-domain antibodies targeting specific epitopes of YedZ could serve as research tools to probe protein function and potentially as therapeutic agents.

  • Microfluidic Systems: These platforms would enable high-throughput screening of YedZ interactions with host factors under controlled conditions mimicking the infection microenvironment.

  • Artificial Intelligence for Experimental Design: Building upon the EDA concept , AI algorithms could optimize experimental protocols for YedZ studies by identifying critical variables and suggesting efficient designs that maximize information gain while minimizing resource use.

Integration of these technologies would significantly accelerate understanding of YedZ biology and its potential applications in vaccine development and therapeutic strategies against P. multocida infections.

How might cross-disciplinary approaches enhance our understanding of YedZ's role in bacterial pathogenesis?

Cross-disciplinary approaches can substantially deepen our understanding of YedZ's role in bacterial pathogenesis through novel perspectives and methodological integration:

Immunology-Biophysics Interface:

  • Combine structural biology techniques with immunological assays to identify immunodominant epitopes on YedZ

  • Correlate protein conformational dynamics with immune recognition patterns

  • Develop structure-based immunogen design approaches informed by epitope mapping

Systems Biology-Veterinary Medicine Collaboration:

  • Integrate transcriptomic and proteomic data from field isolates with experimental challenge studies

  • Map YedZ expression patterns across different host species and infection sites

  • Create predictive models of P. multocida virulence that incorporate YedZ function in different host environments

Computational Biology-Experimental Immunology:

  • Apply machine learning algorithms to predict cross-protective potential of YedZ variants

  • Design in silico experiments to prioritize promising vaccine formulations

  • Develop computational models of host-pathogen interactions that include YedZ functional networks

Molecular Microbiology-Ecology:

  • Investigate YedZ conservation and variation across environmental and pathogenic Pasteurellaceae

  • Study horizontal gene transfer patterns of sulfoxide reductase components

  • Examine evolutionary pressures on YedZ in different ecological niches

Implementation Framework:

  • Establish multidisciplinary research teams with expertise spanning relevant fields

  • Develop shared terminology and conceptual frameworks to facilitate communication

  • Design experiments jointly, incorporating the Experimental Design Assistant methodology

  • Implement integrated data management systems that enable cross-disciplinary analysis

  • Create feedback loops between computational predictions and experimental validation

This cross-disciplinary approach would provide a more comprehensive understanding of YedZ biology than possible within traditional disciplinary boundaries, potentially leading to innovative applications similar to the successful cross-serotype protection strategies demonstrated in recombinant vaccine development .

What are the key considerations for researchers planning to incorporate YedZ studies into their Pasteurella multocida research program?

Researchers planning to incorporate YedZ studies into their P. multocida research program should consider these essential factors:

  • Experimental Design Rigor: Implement systematic design methodologies using tools like the Experimental Design Assistant to minimize bias and maximize reproducibility. Document all design decisions, including sample size calculations, randomization procedures, and blinding protocols .

  • Protein Expression and Purification Optimization: Carefully optimize expression conditions to ensure proper folding and post-translational modifications of YedZ. Consider testing multiple expression systems beyond E. coli if membrane protein integrity issues arise .

  • Functional Validation: Establish reliable assays to confirm that recombinant YedZ retains native functionality before proceeding with complex studies. This validation is critical given the potential differences between recombinant and native forms.

  • Cross-Serotype Considerations: Account for potential variation in YedZ across different P. multocida serotypes, particularly when designing broadly protective vaccines or diagnostic tools. The differential protection observed with OMP36-based vaccines (40-96% depending on serotype) highlights the importance of this consideration .

  • Translational Pathway Planning: Develop a clear roadmap from basic characterization to applied outcomes, whether for vaccine development, diagnostic tools, or therapeutic strategies.

  • Collaborative Networks: Establish partnerships with complementary expertise in structural biology, immunology, and in vivo modeling to enable comprehensive characterization of YedZ biology.

  • Data Management Infrastructure: Implement robust systems for data collection, storage, and analysis that facilitate integration of results from different experimental approaches.

By addressing these considerations systematically, researchers can develop YedZ-focused research programs that contribute meaningful insights to P. multocida pathogenesis understanding and intervention strategies.

How should researchers interpret and integrate conflicting results when studying YedZ function across different experimental systems?

When encountering conflicting results in YedZ function studies across different experimental systems, researchers should implement a structured approach to interpretation and integration:

Systematic Analysis Framework:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.