Recombinant Pasteurella multocida Uncharacterized protein PM0613 (PM0613) is a protein derived from the bacterium Pasteurella multocida. P. multocida is a Gram-negative bacterium known to cause various diseases in animals, including fowl cholera in birds, atrophic rhinitis and pneumonia in swine, and bovine respiratory disease in cattle . PM0613 is a protein of unknown function found in P. multocida . Recombinant PM0613 is produced using genetic engineering techniques, where the gene encoding PM0613 is inserted into a host organism (e.g., Escherichia coli) to produce large quantities of the protein . The recombinant protein can then be purified and used for research purposes, such as studying its potential role in the pathogenicity of P. multocida or as a target for vaccine development .
According to one source, the protein consists of 130 amino acids . The amino acid sequence is: MQILQKIKNITLTSLELIHVRLDMARIELVEQKNFLITLLSALFVIFILLLVSFISLLFGLNSLLDPETKQIVFFAISAGAFFLILILLLLMRKILKKQRNFMVDTLTEVKHDIQAIKGALGSPSSKDQE . The molecular weight and other properties may vary depending on the expression system and purification methods used . The protein is stored in a Tris-based buffer with 50% glycerol for stability . Repeated freezing and thawing is not recommended .
Recombinant PM0613 has several potential applications in research and development:
ELISA assays: Recombinant PM0613 can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect antibodies against P. multocida in serum or other biological samples . This can be useful for diagnosing P. multocida infections or assessing the immune response to vaccines.
Vaccine development: As a conserved protein in P. multocida, PM0613 may be a potential target for vaccine development . Recombinant PM0613 can be used to immunize animals and evaluate the protective efficacy of the induced antibodies against P. multocida infection.
Structural and functional studies: Recombinant PM0613 can be used to determine the three-dimensional structure of the protein and study its biochemical function . This can provide insights into the role of PM0613 in the biology of P. multocida and identify potential targets for therapeutic intervention.
KEGG: pmu:PM0613
STRING: 272843.PM0613
Unlike well-characterized proteins such as P. multocida toxin (PMT), which has established roles in respiratory diseases like pneumonia and progressive atrophic rhinitis (PAR) in swine, PM0613 remains largely uncharacterized in terms of its functional role .
PMT has been extensively studied and categorized into functional domains (N-terminal, middle, and C-terminal regions), each with distinct immunogenic properties . In contrast, PM0613 lacks such detailed domain characterization. Comparative sequence analysis with other P. multocida proteins reveals limited homology, suggesting it may have unique functional properties that differentiate it from other proteins in this pathogen.
The optimal expression system for recombinant PM0613 is E. coli, which has been successfully employed to produce the full-length protein with an N-terminal His-tag . When designing an expression protocol, researchers should consider:
Vector selection: pET-based vectors are commonly used for His-tagged protein expression
E. coli strain optimization: BL21(DE3) or Rosetta strains may enhance expression
Induction parameters: IPTG concentration (typically 0.5-1.0 mM), temperature (reduced to 16-25°C may improve solubility), and duration (4-16 hours)
Lysis conditions: Buffer optimization with detergents may be necessary if PM0613 exhibits membrane protein characteristics
Similar approaches have been successfully used for other P. multocida proteins, including the PMT fragments (PMT-A, PMT-B, PMT-C, and PMT2.3), which were purified using nickel-nitrilotriacetic acid (Ni-NTA) affinity column chromatography .
Verification of recombinant PM0613 should employ multiple complementary approaches:
| Method | Application | Expected Results | Limitations |
|---|---|---|---|
| SDS-PAGE | Molecular weight verification | ~15 kDa band (plus tag contribution) | Limited specificity |
| Western Blot | Immunological confirmation | Positive signal with anti-His antibodies | Requires functional epitopes |
| Mass Spectrometry | Precise mass and sequence verification | Mass matching predicted sequence | Requires specialized equipment |
| PCR | Gene-level confirmation | Amplification of PM0613-specific regions | Doesn't confirm protein expression |
For definitive confirmation, researchers should consider PCR targeting the capsular gene cap specific for P. multocida as described in OIE Manual, which has been successfully applied to detect P. multocida from various sources . The expected PCR product for P. multocida capsular gene is approximately 511-bp, as reported in the OIE manual .
The most effective purification strategy for His-tagged recombinant PM0613 involves:
Initial capture: Ni-NTA affinity chromatography using a linear imidazole gradient (20-250 mM)
Intermediate purification: Size exclusion chromatography to remove aggregates and impurities
Polishing step: Ion exchange chromatography if higher purity is required
This approach has been successfully used for other P. multocida proteins, achieving purities greater than 90% as determined by SDS-PAGE . For optimal results, all purification steps should be performed at 4°C to minimize protein degradation, and protease inhibitors should be included in all buffers.
The final product should be stored in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 to maintain stability .
When designing experiments to investigate PM0613 function, researchers should implement robust panel data experimental designs that account for:
Serial correlation: Traditional methods for experimental design may result in incorrectly powered experiments when proper inference is applied. Failing to account for serial correlation yields overpowered experiments in short panels and underpowered experiments in long panels .
Sample size calculation: Derive analytical expressions for the variance of panel estimators under non-i.i.d. error structures to inform power calculations .
Control groups: Include appropriate controls, such as:
Empty vector controls
Unrelated protein controls
Site-directed mutants of PM0613
Measurement frequency: Determine optimal temporal spacing of measurements based on expected effect size and variance structure.
Following these principles will help achieve correctly powered experiments, as demonstrated in both simulated and real data contexts .
While the specific immunogenic properties of PM0613 have not been fully characterized in the available literature, insights can be drawn from studies of other P. multocida proteins:
In comparative studies of PMT fragments, research has shown varied immunogenic responses. The middle-C-terminal region (PMT2.3) demonstrated the highest protection against homologous challenge, while other fragments showed relatively poor protection . All recombinant proteins except for the N-terminal region (PMT-A) showed immune responses to antisera obtained from swine exhibiting PAR symptoms .
For PM0613, researchers should investigate:
The presence of potential B-cell and T-cell epitopes through computational prediction methods
The ability to stimulate antibody production in animal models
Cross-reactivity with antibodies against other P. multocida proteins
Such investigations would help position PM0613 within the immunological landscape of P. multocida proteins and potentially identify novel vaccine candidates.
Developing an effective ELISA protocol for detecting antibodies against PM0613 requires careful optimization:
Coating conditions: Determine optimal concentration of purified recombinant PM0613 (typically 1-5 μg/mL) in carbonate buffer (pH 9.6) and coat microtiter plates overnight at 4°C.
Blocking conditions: Test various blocking agents (BSA, non-fat milk, commercial blockers) at concentrations ranging from 1-5% to minimize background.
Sample dilution series: Prepare serial dilutions of test sera to determine optimal working dilution.
Standard curve generation: Create standard curves using known positive control sera to enable quantification.
Data analysis: Calculate S/P (sample-to-positive) ratios to determine antibody titers, as demonstrated in previous P. multocida vaccine efficacy studies .
ELISA has been successfully employed by many researchers to determine antibody titers against P. multocida and evaluate fowl cholera vaccine efficacy . This approach can be adapted for PM0613-specific antibody detection with appropriate validation steps.
When encountering contradictory results in PM0613 functional studies, researchers should implement a systematic troubleshooting approach:
Reproducibility assessment: Replicate experiments with standardized protocols across different laboratory settings to identify sources of variation.
Statistical reanalysis: Apply Rasch measurement models, which consider both student ability and task difficulty when analyzing results . This model:
Rearranges response patterns according to Guttman pattern
Scales both items and persons on the same scale
Considers that higher person ability relative to item difficulty increases probability of correct response
Parameter validation: Examine experimental conditions that might influence results:
Protein preparation methods
Expression construct design
Host cell characteristics
Assay conditions and reagents
Multi-method confirmation: Employ orthogonal techniques to verify findings, such as combining immunological, biochemical, and genetic approaches.
The impact of post-translational modifications (PTMs) on PM0613 structure and function requires systematic investigation:
Prediction and identification: Use computational tools to predict potential PTM sites, followed by mass spectrometry analysis to identify actual modifications in native and recombinant PM0613.
Comparative analysis: Compare PTM patterns between recombinant PM0613 expressed in E. coli (which lacks many eukaryotic-like PTM capabilities) with protein isolated directly from P. multocida.
Site-directed mutagenesis: Generate mutants at predicted PTM sites to assess functional consequences.
Structural impact assessment: Use circular dichroism or other structural biology techniques to determine how PTMs affect protein folding and stability.
Understanding PTMs is crucial as they may explain functional differences between recombinant and native PM0613, particularly if the protein's activity depends on specific modifications not replicated in E. coli expression systems.
To predict potential interaction partners for the uncharacterized PM0613 protein, researchers should employ a multi-faceted bioinformatic approach:
Sequence-based methods:
Homology detection to identify proteins with similar sequences
Domain prediction to identify functional domains that might mediate interactions
Motif scanning to detect short interaction-mediating sequences
Structure-based prediction:
Homology modeling of PM0613 structure
Molecular docking simulations with candidate partners
Interface prediction to identify potential binding surfaces
Network-based approaches:
Guilt-by-association analysis using co-expression data
Phylogenetic profiling to identify proteins with similar evolutionary patterns
Literature-based network construction using related P. multocida proteins
Experimental validation planning:
Design pull-down assays for top predicted partners
Develop two-hybrid screens based on prediction results
Plan co-immunoprecipitation experiments with antibodies against predicted partners
These computational predictions should guide subsequent experimental validation to establish the interaction network of PM0613 and inform its biological function.
Determining the biological function of the uncharacterized PM0613 protein requires a comprehensive research strategy:
Genetic manipulation approaches:
Gene knockout studies to observe phenotypic changes
Gene complementation to confirm phenotype restoration
Controlled expression studies to analyze dosage effects
Structural biology methods:
X-ray crystallography or cryo-EM to determine 3D structure
NMR spectroscopy for dynamic structural information
Structure-function predictions based on solved structure
Cellular localization studies:
Immunofluorescence microscopy with anti-PM0613 antibodies
Subcellular fractionation followed by Western blotting
Fusion to reporter proteins (GFP, etc.) to track localization
Transcriptomic and proteomic analyses:
RNA-Seq to identify genes co-regulated with PM0613
Comparative proteomics between wild-type and knockout strains
Protein-protein interaction studies using crosslinking mass spectrometry
By integrating these approaches, researchers can build a comprehensive understanding of PM0613's biological role in P. multocida.
To evaluate PM0613 as a potential vaccine candidate, researchers should design experiments that systematically assess:
Immunogenicity profiling:
Measure antibody responses (IgG, IgA, IgM) in animal models
Assess T-cell responses through proliferation assays and cytokine profiling
Compare responses to established P. multocida vaccine antigens
Protection studies:
Formulation optimization:
Test different adjuvants to enhance immune responses
Evaluate various delivery routes (intramuscular, subcutaneous, mucosal)
Assess dose-response relationships to determine optimal antigen amount
Safety assessment:
Monitor for adverse reactions at injection sites
Evaluate systemic reactions and potential organ toxicity
Assess long-term safety through extended observation periods
Vaccine development should follow the successful methodologies used for other P. multocida vaccines, such as the formalin-killed fowl cholera vaccine approach described in the literature .