Recombinant Pasteurella multocida Uncharacterized protein PM0613 (PM0613)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Pasteurella multocida Uncharacterized protein PM0613 (PM0613) is a protein derived from the bacterium Pasteurella multocida. P. multocida is a Gram-negative bacterium known to cause various diseases in animals, including fowl cholera in birds, atrophic rhinitis and pneumonia in swine, and bovine respiratory disease in cattle . PM0613 is a protein of unknown function found in P. multocida . Recombinant PM0613 is produced using genetic engineering techniques, where the gene encoding PM0613 is inserted into a host organism (e.g., Escherichia coli) to produce large quantities of the protein . The recombinant protein can then be purified and used for research purposes, such as studying its potential role in the pathogenicity of P. multocida or as a target for vaccine development .

Protein Properties

According to one source, the protein consists of 130 amino acids . The amino acid sequence is: MQILQKIKNITLTSLELIHVRLDMARIELVEQKNFLITLLSALFVIFILLLVSFISLLFGLNSLLDPETKQIVFFAISAGAFFLILILLLLMRKILKKQRNFMVDTLTEVKHDIQAIKGALGSPSSKDQE . The molecular weight and other properties may vary depending on the expression system and purification methods used . The protein is stored in a Tris-based buffer with 50% glycerol for stability . Repeated freezing and thawing is not recommended .

Applications

Recombinant PM0613 has several potential applications in research and development:

  • ELISA assays: Recombinant PM0613 can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect antibodies against P. multocida in serum or other biological samples . This can be useful for diagnosing P. multocida infections or assessing the immune response to vaccines.

  • Vaccine development: As a conserved protein in P. multocida, PM0613 may be a potential target for vaccine development . Recombinant PM0613 can be used to immunize animals and evaluate the protective efficacy of the induced antibodies against P. multocida infection.

  • Structural and functional studies: Recombinant PM0613 can be used to determine the three-dimensional structure of the protein and study its biochemical function . This can provide insights into the role of PM0613 in the biology of P. multocida and identify potential targets for therapeutic intervention.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PM0613; Uncharacterized protein PM0613
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM0613
Target Protein Sequence
MQILQKIKNITLTSLELIHVRLDMARIELVEQKNFLITLLSALFVIFILLLVSFISLLFG LNSLLDPETKQIVFFAISAGAFFLILILLLLMRKILKKQRNFMVDTLTEVKHDIQAIKGA LGSPSSKDQE
Uniprot No.

Target Background

Database Links

KEGG: pmu:PM0613

STRING: 272843.PM0613

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does PM0613 compare to other characterized proteins from Pasteurella multocida?

Unlike well-characterized proteins such as P. multocida toxin (PMT), which has established roles in respiratory diseases like pneumonia and progressive atrophic rhinitis (PAR) in swine, PM0613 remains largely uncharacterized in terms of its functional role .

PMT has been extensively studied and categorized into functional domains (N-terminal, middle, and C-terminal regions), each with distinct immunogenic properties . In contrast, PM0613 lacks such detailed domain characterization. Comparative sequence analysis with other P. multocida proteins reveals limited homology, suggesting it may have unique functional properties that differentiate it from other proteins in this pathogen.

What expression systems are optimal for producing recombinant PM0613?

The optimal expression system for recombinant PM0613 is E. coli, which has been successfully employed to produce the full-length protein with an N-terminal His-tag . When designing an expression protocol, researchers should consider:

  • Vector selection: pET-based vectors are commonly used for His-tagged protein expression

  • E. coli strain optimization: BL21(DE3) or Rosetta strains may enhance expression

  • Induction parameters: IPTG concentration (typically 0.5-1.0 mM), temperature (reduced to 16-25°C may improve solubility), and duration (4-16 hours)

  • Lysis conditions: Buffer optimization with detergents may be necessary if PM0613 exhibits membrane protein characteristics

Similar approaches have been successfully used for other P. multocida proteins, including the PMT fragments (PMT-A, PMT-B, PMT-C, and PMT2.3), which were purified using nickel-nitrilotriacetic acid (Ni-NTA) affinity column chromatography .

What are the most reliable methods for confirming the identity of recombinant PM0613?

Verification of recombinant PM0613 should employ multiple complementary approaches:

MethodApplicationExpected ResultsLimitations
SDS-PAGEMolecular weight verification~15 kDa band (plus tag contribution)Limited specificity
Western BlotImmunological confirmationPositive signal with anti-His antibodiesRequires functional epitopes
Mass SpectrometryPrecise mass and sequence verificationMass matching predicted sequenceRequires specialized equipment
PCRGene-level confirmationAmplification of PM0613-specific regionsDoesn't confirm protein expression

For definitive confirmation, researchers should consider PCR targeting the capsular gene cap specific for P. multocida as described in OIE Manual, which has been successfully applied to detect P. multocida from various sources . The expected PCR product for P. multocida capsular gene is approximately 511-bp, as reported in the OIE manual .

What purification strategies yield the highest purity of recombinant PM0613?

The most effective purification strategy for His-tagged recombinant PM0613 involves:

  • Initial capture: Ni-NTA affinity chromatography using a linear imidazole gradient (20-250 mM)

  • Intermediate purification: Size exclusion chromatography to remove aggregates and impurities

  • Polishing step: Ion exchange chromatography if higher purity is required

This approach has been successfully used for other P. multocida proteins, achieving purities greater than 90% as determined by SDS-PAGE . For optimal results, all purification steps should be performed at 4°C to minimize protein degradation, and protease inhibitors should be included in all buffers.

The final product should be stored in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 to maintain stability .

How should researchers design panel experiments to evaluate PM0613 function?

When designing experiments to investigate PM0613 function, researchers should implement robust panel data experimental designs that account for:

  • Serial correlation: Traditional methods for experimental design may result in incorrectly powered experiments when proper inference is applied. Failing to account for serial correlation yields overpowered experiments in short panels and underpowered experiments in long panels .

  • Sample size calculation: Derive analytical expressions for the variance of panel estimators under non-i.i.d. error structures to inform power calculations .

  • Control groups: Include appropriate controls, such as:

    • Empty vector controls

    • Unrelated protein controls

    • Site-directed mutants of PM0613

  • Measurement frequency: Determine optimal temporal spacing of measurements based on expected effect size and variance structure.

Following these principles will help achieve correctly powered experiments, as demonstrated in both simulated and real data contexts .

What is known about the immunogenicity of PM0613 compared to other P. multocida proteins?

While the specific immunogenic properties of PM0613 have not been fully characterized in the available literature, insights can be drawn from studies of other P. multocida proteins:

In comparative studies of PMT fragments, research has shown varied immunogenic responses. The middle-C-terminal region (PMT2.3) demonstrated the highest protection against homologous challenge, while other fragments showed relatively poor protection . All recombinant proteins except for the N-terminal region (PMT-A) showed immune responses to antisera obtained from swine exhibiting PAR symptoms .

For PM0613, researchers should investigate:

  • The presence of potential B-cell and T-cell epitopes through computational prediction methods

  • The ability to stimulate antibody production in animal models

  • Cross-reactivity with antibodies against other P. multocida proteins

Such investigations would help position PM0613 within the immunological landscape of P. multocida proteins and potentially identify novel vaccine candidates.

How can researchers effectively design ELISA protocols to detect antibodies against PM0613?

Developing an effective ELISA protocol for detecting antibodies against PM0613 requires careful optimization:

  • Coating conditions: Determine optimal concentration of purified recombinant PM0613 (typically 1-5 μg/mL) in carbonate buffer (pH 9.6) and coat microtiter plates overnight at 4°C.

  • Blocking conditions: Test various blocking agents (BSA, non-fat milk, commercial blockers) at concentrations ranging from 1-5% to minimize background.

  • Sample dilution series: Prepare serial dilutions of test sera to determine optimal working dilution.

  • Standard curve generation: Create standard curves using known positive control sera to enable quantification.

  • Data analysis: Calculate S/P (sample-to-positive) ratios to determine antibody titers, as demonstrated in previous P. multocida vaccine efficacy studies .

ELISA has been successfully employed by many researchers to determine antibody titers against P. multocida and evaluate fowl cholera vaccine efficacy . This approach can be adapted for PM0613-specific antibody detection with appropriate validation steps.

What approaches can resolve data contradictions in PM0613 functional studies?

When encountering contradictory results in PM0613 functional studies, researchers should implement a systematic troubleshooting approach:

  • Reproducibility assessment: Replicate experiments with standardized protocols across different laboratory settings to identify sources of variation.

  • Statistical reanalysis: Apply Rasch measurement models, which consider both student ability and task difficulty when analyzing results . This model:

    • Rearranges response patterns according to Guttman pattern

    • Scales both items and persons on the same scale

    • Considers that higher person ability relative to item difficulty increases probability of correct response

  • Parameter validation: Examine experimental conditions that might influence results:

    • Protein preparation methods

    • Expression construct design

    • Host cell characteristics

    • Assay conditions and reagents

  • Multi-method confirmation: Employ orthogonal techniques to verify findings, such as combining immunological, biochemical, and genetic approaches.

How does post-translational modification affect PM0613 structure and function?

The impact of post-translational modifications (PTMs) on PM0613 structure and function requires systematic investigation:

  • Prediction and identification: Use computational tools to predict potential PTM sites, followed by mass spectrometry analysis to identify actual modifications in native and recombinant PM0613.

  • Comparative analysis: Compare PTM patterns between recombinant PM0613 expressed in E. coli (which lacks many eukaryotic-like PTM capabilities) with protein isolated directly from P. multocida.

  • Site-directed mutagenesis: Generate mutants at predicted PTM sites to assess functional consequences.

  • Structural impact assessment: Use circular dichroism or other structural biology techniques to determine how PTMs affect protein folding and stability.

Understanding PTMs is crucial as they may explain functional differences between recombinant and native PM0613, particularly if the protein's activity depends on specific modifications not replicated in E. coli expression systems.

What bioinformatic approaches can predict potential interaction partners for PM0613?

To predict potential interaction partners for the uncharacterized PM0613 protein, researchers should employ a multi-faceted bioinformatic approach:

  • Sequence-based methods:

    • Homology detection to identify proteins with similar sequences

    • Domain prediction to identify functional domains that might mediate interactions

    • Motif scanning to detect short interaction-mediating sequences

  • Structure-based prediction:

    • Homology modeling of PM0613 structure

    • Molecular docking simulations with candidate partners

    • Interface prediction to identify potential binding surfaces

  • Network-based approaches:

    • Guilt-by-association analysis using co-expression data

    • Phylogenetic profiling to identify proteins with similar evolutionary patterns

    • Literature-based network construction using related P. multocida proteins

  • Experimental validation planning:

    • Design pull-down assays for top predicted partners

    • Develop two-hybrid screens based on prediction results

    • Plan co-immunoprecipitation experiments with antibodies against predicted partners

These computational predictions should guide subsequent experimental validation to establish the interaction network of PM0613 and inform its biological function.

What are the most promising approaches for determining the biological function of PM0613?

Determining the biological function of the uncharacterized PM0613 protein requires a comprehensive research strategy:

  • Genetic manipulation approaches:

    • Gene knockout studies to observe phenotypic changes

    • Gene complementation to confirm phenotype restoration

    • Controlled expression studies to analyze dosage effects

  • Structural biology methods:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • NMR spectroscopy for dynamic structural information

    • Structure-function predictions based on solved structure

  • Cellular localization studies:

    • Immunofluorescence microscopy with anti-PM0613 antibodies

    • Subcellular fractionation followed by Western blotting

    • Fusion to reporter proteins (GFP, etc.) to track localization

  • Transcriptomic and proteomic analyses:

    • RNA-Seq to identify genes co-regulated with PM0613

    • Comparative proteomics between wild-type and knockout strains

    • Protein-protein interaction studies using crosslinking mass spectrometry

By integrating these approaches, researchers can build a comprehensive understanding of PM0613's biological role in P. multocida.

How can researchers design experiments to evaluate PM0613 as a potential vaccine candidate?

To evaluate PM0613 as a potential vaccine candidate, researchers should design experiments that systematically assess:

  • Immunogenicity profiling:

    • Measure antibody responses (IgG, IgA, IgM) in animal models

    • Assess T-cell responses through proliferation assays and cytokine profiling

    • Compare responses to established P. multocida vaccine antigens

  • Protection studies:

    • Design challenge experiments with virulent P. multocida strains

    • Evaluate parameters including survival rate, bacterial clearance, and clinical scores

    • Compare protection with established vaccines, similar to studies conducted with PMT fragments

  • Formulation optimization:

    • Test different adjuvants to enhance immune responses

    • Evaluate various delivery routes (intramuscular, subcutaneous, mucosal)

    • Assess dose-response relationships to determine optimal antigen amount

  • Safety assessment:

    • Monitor for adverse reactions at injection sites

    • Evaluate systemic reactions and potential organ toxicity

    • Assess long-term safety through extended observation periods

Vaccine development should follow the successful methodologies used for other P. multocida vaccines, such as the formalin-killed fowl cholera vaccine approach described in the literature .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.