Recombinant Pasteurella multocida Uncharacterized protein PM0682 (PM0682)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pasteurella multocida Uncharacterized Protein PM0682 (PM0682)

Recombinant Pasteurella multocida PM0682 is a full-length, His-tagged protein derived from the bacterial pathogen Pasteurella multocida, expressed in E. coli. Designated by UniProt ID Q9CMX0, this uncharacterized protein spans 102 amino acids (aa 1–102) and is primarily used in research to study bacterial pathogenicity, vaccine development, and molecular interactions .

Amino Acid Sequence

The AA sequence of PM0682 is:
MLGYRQAVRHRVLISAFLGSNPSTPAILSNNLHPLHIKIFQLGYRQAVRHRVLISAFLGS NPSTPAITFLNFDFTYFVLRLFYFYFKIFIIFSNLFYRYFPF .

Production and Functional Context

PM0682 is synthesized via recombinant DNA technology, with E. coli serving as the expression system. The protein is purified using affinity chromatography (e.g., His-Ni columns) and is lyophilized for stability . While its exact biological role remains uncharacterized, its availability as a recombinant protein facilitates studies on P. multocida pathogenesis, host-pathogen interactions, and vaccine antigenicity.

Vaccine Development

PM0682 is marketed as a research tool for vaccine development, though no peer-reviewed studies directly link it to protective efficacy. By contrast, other P. multocida proteins like PlpE and OmpH have demonstrated immunogenicity in duck models, with combination vaccines showing enhanced protection . PM0682’s potential in similar contexts remains unexplored.

Pathogenicity Studies

While PM0682 is not yet implicated in virulence, related P. multocida proteins (e.g., Pm0442) regulate critical virulence factors such as capsule synthesis, lipopolysaccharide (LPS) production, and iron utilization . Future studies may investigate whether PM0682 interacts with analogous pathways.

Challenges and Gaps in Knowledge

  1. Functional Elucidation: PM0682’s role in bacterial physiology or pathogenesis is undefined.

  2. Immunogenicity Data: No published studies evaluate its capacity to elicit protective immunity.

  3. Structural Insights: Crystallographic or NMR data to predict binding partners or enzymatic activity are lacking.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your desired format in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To preserve the integrity of the protein, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We are committed to fulfilling specific tag type requests. If you have a preferred tag type, please let us know and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM0682
Target Protein Sequence
MLGYRQAVRHRVLISAFLGSNPSTPAILSNNLHPLHIKIFQLGYRQAVRHRVLISAFLGS NPSTPAITFLNFDFTYFVLRLFYFYFKIFIIFSNLFYRYFPF
Uniprot No.

Q&A

What expression systems are most effective for producing recombinant PM0682?

Based on established protocols for similar P. multocida proteins, E. coli expression systems are the most commonly used and effective approach for producing recombinant PM0682. The methodology typically follows these steps:

  • PCR amplification of the PM0682 gene from P. multocida genomic DNA

  • Cloning into an expression vector (commonly pET series vectors)

  • Transformation into E. coli BL21(DE3) or similar expression strains

  • Induction of protein expression using IPTG

  • Cell lysis and protein purification via affinity chromatography

For optimal expression, researchers should consider:

  • Codon optimization for the E. coli host

  • Temperature optimization (typically 16-37°C)

  • IPTG concentration optimization

  • Inclusion of protease inhibitors during purification

A similar approach was successfully used for other P. multocida proteins like VacJ, PlpE, and OmpH, which were cloned into pET43.1a to express his-tagged fusion proteins with yields sufficient for immunological studies .

What bioinformatic approaches can help predict the function of PM0682?

For uncharacterized proteins like PM0682, a multi-faceted bioinformatics pipeline can provide functional insights:

Analytical ApproachTools/DatabasesApplication to PM0682
Sequence homologyBLAST, HHpredIdentify evolutionary relationships with characterized proteins
Domain predictionPfam, InterPro, CDD-BLASTIdentify functional domains within PM0682
Structural predictionSWISS-MODEL, AlphaFoldGenerate 3D models to predict functional sites
Protein-protein interactionSTRING databasePredict interaction partners and functional networks
Subcellular localizationPSORT, SignalP, TMHMMPredict cellular location for functional context
Physicochemical analysisProtParam, ProtScaleCharacterize stability, solubility, and other properties

This structured approach has demonstrated 98% accuracy in functional annotation of hypothetical proteins in similar studies with Bacillus paralicheniformis . The analysis should incorporate multiple tools for each category to improve prediction confidence and cross-validate findings.

For PM0682 specifically, careful attention should be paid to sequence similarities with virulence factors, as other P. multocida proteins regulate critical virulence mechanisms such as capsule synthesis, LPS production, and iron utilization.

How can protein-protein interaction studies help elucidate PM0682's function?

Protein-protein interaction (PPI) studies are critical for understanding the biological function of uncharacterized proteins like PM0682 within their cellular network. The following methodological approach is recommended:

  • In silico PPI prediction:

    • Use STRING database to identify potential interaction partners based on genomic context, co-expression, and text mining

    • Apply computational algorithms that predict interactions based on structural complementarity

  • Experimental validation:

    • Yeast two-hybrid (Y2H) screening using PM0682 as bait against a P. multocida genomic library

    • Co-immunoprecipitation (Co-IP) using anti-His antibodies followed by mass spectrometry

    • Bacterial two-hybrid systems optimized for prokaryotic protein interactions

    • Surface plasmon resonance (SPR) for quantitative binding analysis

  • Network analysis:

    • Construction of interaction networks to identify functional clusters

    • Pathway enrichment analysis of interacting partners

Understanding the protein-protein interaction network of PM0682 could provide insights into whether it interacts with known virulence factors or regulatory proteins in P. multocida. This approach has successfully revealed functions of hypothetical proteins in multiple bacterial systems, including the identification of proteins involved in sporulation, biofilm formation, and transcriptional regulation .

What are the best methods to determine the subcellular localization of PM0682?

Determining the subcellular localization of PM0682 is essential for understanding its biological function. A comprehensive approach should include both computational prediction and experimental verification:

Computational prediction methods:

  • SignalP for signal peptide prediction

  • TMHMM or HMMTOP for transmembrane domain identification

  • PSORTb for general bacterial protein localization

  • LipoP for lipoprotein prediction

  • SecretomeP for non-classical secretion prediction

Experimental verification methods:

  • Cell fractionation and Western blotting:

    • Separate bacterial cellular compartments (cytoplasm, membrane, periplasm, secreted fraction)

    • Detect PM0682 using anti-His antibodies or custom antibodies against PM0682

    • Include known markers for each fraction as controls

  • Immunofluorescence microscopy:

    • Fix and permeabilize bacterial cells

    • Label PM0682 with specific antibodies and fluorescent secondary antibodies

    • Co-localize with known compartment markers

  • Reporter fusion systems:

    • Generate translational fusions with GFP or other fluorescent proteins

    • Observe localization in live cells

    • Verify that fusion doesn't disrupt native localization signals

  • Surface accessibility assays:

    • Protease accessibility tests for surface-exposed proteins

    • Biotinylation of surface proteins followed by pull-down experiments

For PM0682, special consideration should be given to potential membrane association, as many uncharacterized bacterial proteins with roles in pathogenicity are associated with the membrane or are secreted to interact with host cells .

What approaches can determine if PM0682 has enzymatic activity?

Uncovering potential enzymatic activity of PM0682 requires a systematic approach combining structural predictions and activity screening:

  • Structure-based prediction:

    • Perform 3D structure prediction using AlphaFold or SWISS-MODEL

    • Analyze structural features for catalytic site signatures

    • Compare with known enzyme structural databases

  • Generic enzyme activity screening:

    • Test for common enzymatic activities (hydrolase, transferase, oxidoreductase)

    • Employ colorimetric assays for various substrate classes

    • Use enzymatic activity microarrays for broad screening

  • Targeted activity testing based on structural predictions:

    • If structural homology suggests specific enzyme class, test with relevant substrates

    • Measure reaction kinetics with purified recombinant protein

    • Perform site-directed mutagenesis of predicted catalytic residues to confirm

  • Metabolomic approaches:

    • Compare metabolite profiles between wild-type and PM0682 knockout/overexpression strains

    • Identify accumulated substrates or depleted products

  • Isothermal titration calorimetry (ITC):

    • Screen for binding of potential cofactors or substrates

    • Quantify binding thermodynamics to identify physiologically relevant interactions

A similar approach has been successfully applied to other uncharacterized bacterial proteins, leading to the discovery of novel enzymes involved in rare-sugar biosynthesis, antibiotic biosynthesis, and bioremediation .

How can researchers evaluate PM0682's potential as a vaccine candidate?

Evaluating PM0682 as a potential vaccine candidate requires a systematic approach:

  • Immunogenicity assessment:

    • Test antibody production in animal models using purified recombinant PM0682

    • Measure humoral (IgG, IgA) and cellular (T-cell) immune responses

    • Compare immunogenicity with established P. multocida antigens like PlpE and OmpH

  • Protective efficacy evaluation:

    • Challenge immunized animals with virulent P. multocida strains

    • Determine survival rates and bacterial loads

    • Compare with established vaccines and adjuvant-only controls

  • Adjuvant optimization:

    • Test various adjuvant formulations (oil-based, aluminum salts, TLR agonists)

    • Evaluate adjuvant effects on immunogenicity and protection

  • Combination vaccine assessment:

    • Test PM0682 in combination with known protective antigens (e.g., PlpE, OmpH)

    • Evaluate for synergistic or additive protection

    • Measure combination effects on immunogenicity

Based on studies with other P. multocida proteins, a promising approach would be to emulsify the recombinant protein with a single oil-packed adjuvant before inoculation. For reference, similar studies with recombinant VacJ, PlpE, and OmpH showed protection rates of 33.33%, 83.33%, 83.33%, 100% (combined), and 50% (killed vaccine) respectively . Testing combinations is particularly important as the combined formulation of VacJ+PlpE+OmpH showed enhanced immunogenicity compared to individual components .

What techniques can identify immunogenic epitopes within PM0682?

Identifying immunogenic epitopes within PM0682 requires a combination of computational prediction and experimental validation approaches:

  • Computational epitope prediction:

    • B-cell epitope prediction using algorithms like BepiPred, ABCpred

    • T-cell epitope prediction using tools like NetMHC, IEDB, and SYFPEITHI

    • Structural epitope prediction using 3D models and surface accessibility analysis

  • Experimental epitope mapping:

    • Peptide microarray analysis with overlapping peptides spanning PM0682

    • ELISA with synthetic peptides against sera from infected/immunized animals

    • Phage display libraries for conformational epitope identification

    • X-ray crystallography of antibody-antigen complexes for precise epitope mapping

  • Epitope validation:

    • Synthesize predicted epitope peptides and test immunogenicity

    • Generate epitope-specific antibodies and test neutralization capacity

    • Perform site-directed mutagenesis of predicted epitopes to confirm importance

  • Cross-reactivity assessment:

    • Test epitope conservation across different P. multocida strains

    • Evaluate cross-protection between strains after immunization with epitope-based vaccines

This systematic approach would help identify which regions of PM0682 are most immunogenic and could potentially be incorporated into peptide-based or epitope-focused vaccine formulations, potentially improving upon the whole-protein approach used with other P. multocida antigens .

What gene knockout strategies are most effective for studying PM0682 function in P. multocida?

Developing effective gene knockout strategies for PM0682 in P. multocida requires consideration of several methodological approaches:

  • Homologous recombination techniques:

    • Design targeting vectors with antibiotic resistance cassettes flanked by homology arms

    • Transform via electroporation or conjugation

    • Select for double crossover events using positive/negative selection

    • Verify gene deletion by PCR and sequencing

  • CRISPR-Cas9 system adaptation:

    • Design sgRNAs targeting PM0682

    • Deliver Cas9 and sgRNA via plasmid vectors optimized for P. multocida

    • Include repair templates for precise gene editing

    • Screen transformants for successful editing events

  • Conditional knockout systems:

    • Implement inducible promoter systems (tetracycline-responsive)

    • Create temperature-sensitive alleles

    • Develop degron-tagged versions of PM0682 for controlled protein degradation

  • Phenotypic characterization of knockouts:

    • Growth curves under various conditions

    • Virulence assessment in cellular and animal models

    • Transcriptomic and proteomic profiling to identify affected pathways

    • Complementation studies to confirm phenotype specificity

Special considerations for P. multocida include:

  • Low transformation efficiency requiring optimization of electroporation parameters

  • Limited genetic tools compared to model organisms

  • Potential essentiality of the gene requiring conditional approaches

  • Capsule interference with transformation requiring acapsular strains for initial method development

This approach allows researchers to definitively link PM0682 to specific phenotypes and determine whether it plays roles in key virulence mechanisms similar to other P. multocida proteins that regulate capsule synthesis, LPS production, and iron utilization .

How can transcriptomic analyses help understand the regulatory context of PM0682?

Transcriptomic analyses provide valuable insights into the regulatory networks involving PM0682:

  • RNA-Seq experimental design:

    • Compare wild-type vs. PM0682 knockout strains

    • Analyze expression under various conditions (nutrient limitation, host-mimicking environments)

    • Include time-course experiments to capture dynamic responses

    • Compare transcriptomes across different growth phases

  • Data analysis pipeline:

    • Quality control and read mapping to P. multocida genome

    • Differential expression analysis with appropriate statistical thresholds

    • Pathway and gene ontology enrichment analysis

    • Co-expression network construction

  • Integration with other omics data:

    • Correlate transcriptomic changes with proteomic alterations

    • Connect with metabolomic shifts to identify functional impacts

    • Integrate with ChIP-seq data if PM0682 is suspected to have DNA-binding properties

  • Validation experiments:

    • qRT-PCR validation of key differentially expressed genes

    • Reporter gene assays for promoter activity analysis

    • Electrophoretic mobility shift assays (EMSA) if DNA-binding is suspected

This approach can reveal whether PM0682 functions in regulatory networks, potentially identifying co-regulated genes and biological processes affected by PM0682 expression. It may also provide insights into whether PM0682 is involved in stress responses, virulence regulation, or metabolic pathways in P. multocida .

How can structural biology techniques be applied to characterize PM0682?

Structural characterization of PM0682 requires a multi-technique approach to overcome challenges associated with uncharacterized proteins:

  • X-ray crystallography workflow:

    • Optimize expression and purification for high protein homogeneity

    • Perform crystallization screening (sparse matrix, grid screens)

    • Optimize crystallization conditions for diffraction-quality crystals

    • Data collection at synchrotron facilities

    • Structure solution by molecular replacement or experimental phasing

    • Model building, refinement, and validation

  • NMR spectroscopy approach:

    • Express isotopically labeled protein (15N, 13C)

    • Acquire multidimensional NMR spectra (HSQC, NOESY, TOCSY)

    • Assign backbone and side-chain resonances

    • Calculate solution structure using distance restraints

    • Analyze dynamics and potential ligand interactions

  • Cryo-electron microscopy:

    • Particularly useful if PM0682 forms larger complexes

    • Sample preparation on grids and vitrification

    • Data collection and processing

    • 3D reconstruction and model building

  • Complementary biophysical techniques:

    • Circular dichroism for secondary structure assessment

    • Small-angle X-ray scattering (SAXS) for solution shape

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and interactions

  • Computational structure prediction integration:

    • Compare experimental structures with AlphaFold predictions

    • Use computational models to guide experimental design

    • Molecular dynamics simulations to explore conformational space

Structural information would provide crucial insights into potential functional sites, interaction surfaces, and evolutionary relationships of PM0682, potentially revealing its role in P. multocida pathogenesis .

What approaches can determine if PM0682 contributes to antimicrobial resistance in P. multocida?

Investigating PM0682's potential role in antimicrobial resistance requires a comprehensive approach:

  • Comparative susceptibility testing:

    • Determine Minimum Inhibitory Concentrations (MICs) for wild-type vs. PM0682 knockout strains

    • Test against clinically relevant antibiotics (penicillins, tetracyclines, fluoroquinolones)

    • Analyze changes in resistance profiles under different growth conditions

    • Include β-lactamase activity assays to detect potential enzymatic resistance mechanisms

  • Gene expression analysis:

    • Examine PM0682 expression changes in response to antibiotic exposure

    • Monitor expression of known resistance genes in PM0682 mutants

    • Perform RNA-Seq to identify global transcriptional changes affecting resistance

  • Functional characterization:

    • Test for direct antibiotic binding or modification using purified recombinant PM0682

    • Examine membrane permeability changes in PM0682 mutants

    • Investigate efflux pump activity differences between wild-type and mutant strains

  • Genetic complementation and overexpression studies:

    • Restore wild-type PM0682 expression in knockout strains to confirm phenotype

    • Overexpress PM0682 to assess if increased expression enhances resistance

    • Introduce PM0682 into heterologous hosts to test transferability of resistance phenotypes

  • Clinical isolate correlation studies:

    • Survey PM0682 sequence variations across clinical isolates with different resistance profiles

    • Correlate gene expression levels with resistance patterns

    • Identify potential mutations associated with resistance development

This systematic approach would determine whether PM0682 contributes to the reported phenomenon of antibiotic resistance in P. multocida, particularly given that penicillin-resistant strains have been reported and β-lactamase positivity was found in 16 percent of infected individuals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.