Recombinant Pasteurella multocida PM0682 is a full-length, His-tagged protein derived from the bacterial pathogen Pasteurella multocida, expressed in E. coli. Designated by UniProt ID Q9CMX0, this uncharacterized protein spans 102 amino acids (aa 1–102) and is primarily used in research to study bacterial pathogenicity, vaccine development, and molecular interactions .
The AA sequence of PM0682 is:
MLGYRQAVRHRVLISAFLGSNPSTPAILSNNLHPLHIKIFQLGYRQAVRHRVLISAFLGS NPSTPAITFLNFDFTYFVLRLFYFYFKIFIIFSNLFYRYFPF .
PM0682 is synthesized via recombinant DNA technology, with E. coli serving as the expression system. The protein is purified using affinity chromatography (e.g., His-Ni columns) and is lyophilized for stability . While its exact biological role remains uncharacterized, its availability as a recombinant protein facilitates studies on P. multocida pathogenesis, host-pathogen interactions, and vaccine antigenicity.
PM0682 is marketed as a research tool for vaccine development, though no peer-reviewed studies directly link it to protective efficacy. By contrast, other P. multocida proteins like PlpE and OmpH have demonstrated immunogenicity in duck models, with combination vaccines showing enhanced protection . PM0682’s potential in similar contexts remains unexplored.
While PM0682 is not yet implicated in virulence, related P. multocida proteins (e.g., Pm0442) regulate critical virulence factors such as capsule synthesis, lipopolysaccharide (LPS) production, and iron utilization . Future studies may investigate whether PM0682 interacts with analogous pathways.
Functional Elucidation: PM0682’s role in bacterial physiology or pathogenesis is undefined.
Immunogenicity Data: No published studies evaluate its capacity to elicit protective immunity.
Structural Insights: Crystallographic or NMR data to predict binding partners or enzymatic activity are lacking.
Based on established protocols for similar P. multocida proteins, E. coli expression systems are the most commonly used and effective approach for producing recombinant PM0682. The methodology typically follows these steps:
PCR amplification of the PM0682 gene from P. multocida genomic DNA
Cloning into an expression vector (commonly pET series vectors)
Transformation into E. coli BL21(DE3) or similar expression strains
Induction of protein expression using IPTG
Cell lysis and protein purification via affinity chromatography
For optimal expression, researchers should consider:
Codon optimization for the E. coli host
Temperature optimization (typically 16-37°C)
IPTG concentration optimization
Inclusion of protease inhibitors during purification
A similar approach was successfully used for other P. multocida proteins like VacJ, PlpE, and OmpH, which were cloned into pET43.1a to express his-tagged fusion proteins with yields sufficient for immunological studies .
For uncharacterized proteins like PM0682, a multi-faceted bioinformatics pipeline can provide functional insights:
| Analytical Approach | Tools/Databases | Application to PM0682 |
|---|---|---|
| Sequence homology | BLAST, HHpred | Identify evolutionary relationships with characterized proteins |
| Domain prediction | Pfam, InterPro, CDD-BLAST | Identify functional domains within PM0682 |
| Structural prediction | SWISS-MODEL, AlphaFold | Generate 3D models to predict functional sites |
| Protein-protein interaction | STRING database | Predict interaction partners and functional networks |
| Subcellular localization | PSORT, SignalP, TMHMM | Predict cellular location for functional context |
| Physicochemical analysis | ProtParam, ProtScale | Characterize stability, solubility, and other properties |
This structured approach has demonstrated 98% accuracy in functional annotation of hypothetical proteins in similar studies with Bacillus paralicheniformis . The analysis should incorporate multiple tools for each category to improve prediction confidence and cross-validate findings.
For PM0682 specifically, careful attention should be paid to sequence similarities with virulence factors, as other P. multocida proteins regulate critical virulence mechanisms such as capsule synthesis, LPS production, and iron utilization.
Protein-protein interaction (PPI) studies are critical for understanding the biological function of uncharacterized proteins like PM0682 within their cellular network. The following methodological approach is recommended:
In silico PPI prediction:
Use STRING database to identify potential interaction partners based on genomic context, co-expression, and text mining
Apply computational algorithms that predict interactions based on structural complementarity
Experimental validation:
Yeast two-hybrid (Y2H) screening using PM0682 as bait against a P. multocida genomic library
Co-immunoprecipitation (Co-IP) using anti-His antibodies followed by mass spectrometry
Bacterial two-hybrid systems optimized for prokaryotic protein interactions
Surface plasmon resonance (SPR) for quantitative binding analysis
Network analysis:
Construction of interaction networks to identify functional clusters
Pathway enrichment analysis of interacting partners
Understanding the protein-protein interaction network of PM0682 could provide insights into whether it interacts with known virulence factors or regulatory proteins in P. multocida. This approach has successfully revealed functions of hypothetical proteins in multiple bacterial systems, including the identification of proteins involved in sporulation, biofilm formation, and transcriptional regulation .
Determining the subcellular localization of PM0682 is essential for understanding its biological function. A comprehensive approach should include both computational prediction and experimental verification:
Computational prediction methods:
SignalP for signal peptide prediction
TMHMM or HMMTOP for transmembrane domain identification
PSORTb for general bacterial protein localization
LipoP for lipoprotein prediction
SecretomeP for non-classical secretion prediction
Experimental verification methods:
Cell fractionation and Western blotting:
Separate bacterial cellular compartments (cytoplasm, membrane, periplasm, secreted fraction)
Detect PM0682 using anti-His antibodies or custom antibodies against PM0682
Include known markers for each fraction as controls
Immunofluorescence microscopy:
Fix and permeabilize bacterial cells
Label PM0682 with specific antibodies and fluorescent secondary antibodies
Co-localize with known compartment markers
Reporter fusion systems:
Generate translational fusions with GFP or other fluorescent proteins
Observe localization in live cells
Verify that fusion doesn't disrupt native localization signals
Surface accessibility assays:
Protease accessibility tests for surface-exposed proteins
Biotinylation of surface proteins followed by pull-down experiments
For PM0682, special consideration should be given to potential membrane association, as many uncharacterized bacterial proteins with roles in pathogenicity are associated with the membrane or are secreted to interact with host cells .
Uncovering potential enzymatic activity of PM0682 requires a systematic approach combining structural predictions and activity screening:
Structure-based prediction:
Perform 3D structure prediction using AlphaFold or SWISS-MODEL
Analyze structural features for catalytic site signatures
Compare with known enzyme structural databases
Generic enzyme activity screening:
Test for common enzymatic activities (hydrolase, transferase, oxidoreductase)
Employ colorimetric assays for various substrate classes
Use enzymatic activity microarrays for broad screening
Targeted activity testing based on structural predictions:
If structural homology suggests specific enzyme class, test with relevant substrates
Measure reaction kinetics with purified recombinant protein
Perform site-directed mutagenesis of predicted catalytic residues to confirm
Metabolomic approaches:
Compare metabolite profiles between wild-type and PM0682 knockout/overexpression strains
Identify accumulated substrates or depleted products
Isothermal titration calorimetry (ITC):
Screen for binding of potential cofactors or substrates
Quantify binding thermodynamics to identify physiologically relevant interactions
A similar approach has been successfully applied to other uncharacterized bacterial proteins, leading to the discovery of novel enzymes involved in rare-sugar biosynthesis, antibiotic biosynthesis, and bioremediation .
Evaluating PM0682 as a potential vaccine candidate requires a systematic approach:
Immunogenicity assessment:
Test antibody production in animal models using purified recombinant PM0682
Measure humoral (IgG, IgA) and cellular (T-cell) immune responses
Compare immunogenicity with established P. multocida antigens like PlpE and OmpH
Protective efficacy evaluation:
Challenge immunized animals with virulent P. multocida strains
Determine survival rates and bacterial loads
Compare with established vaccines and adjuvant-only controls
Adjuvant optimization:
Test various adjuvant formulations (oil-based, aluminum salts, TLR agonists)
Evaluate adjuvant effects on immunogenicity and protection
Combination vaccine assessment:
Test PM0682 in combination with known protective antigens (e.g., PlpE, OmpH)
Evaluate for synergistic or additive protection
Measure combination effects on immunogenicity
Based on studies with other P. multocida proteins, a promising approach would be to emulsify the recombinant protein with a single oil-packed adjuvant before inoculation. For reference, similar studies with recombinant VacJ, PlpE, and OmpH showed protection rates of 33.33%, 83.33%, 83.33%, 100% (combined), and 50% (killed vaccine) respectively . Testing combinations is particularly important as the combined formulation of VacJ+PlpE+OmpH showed enhanced immunogenicity compared to individual components .
Identifying immunogenic epitopes within PM0682 requires a combination of computational prediction and experimental validation approaches:
Computational epitope prediction:
B-cell epitope prediction using algorithms like BepiPred, ABCpred
T-cell epitope prediction using tools like NetMHC, IEDB, and SYFPEITHI
Structural epitope prediction using 3D models and surface accessibility analysis
Experimental epitope mapping:
Peptide microarray analysis with overlapping peptides spanning PM0682
ELISA with synthetic peptides against sera from infected/immunized animals
Phage display libraries for conformational epitope identification
X-ray crystallography of antibody-antigen complexes for precise epitope mapping
Epitope validation:
Synthesize predicted epitope peptides and test immunogenicity
Generate epitope-specific antibodies and test neutralization capacity
Perform site-directed mutagenesis of predicted epitopes to confirm importance
Cross-reactivity assessment:
Test epitope conservation across different P. multocida strains
Evaluate cross-protection between strains after immunization with epitope-based vaccines
This systematic approach would help identify which regions of PM0682 are most immunogenic and could potentially be incorporated into peptide-based or epitope-focused vaccine formulations, potentially improving upon the whole-protein approach used with other P. multocida antigens .
Developing effective gene knockout strategies for PM0682 in P. multocida requires consideration of several methodological approaches:
Homologous recombination techniques:
Design targeting vectors with antibiotic resistance cassettes flanked by homology arms
Transform via electroporation or conjugation
Select for double crossover events using positive/negative selection
Verify gene deletion by PCR and sequencing
CRISPR-Cas9 system adaptation:
Design sgRNAs targeting PM0682
Deliver Cas9 and sgRNA via plasmid vectors optimized for P. multocida
Include repair templates for precise gene editing
Screen transformants for successful editing events
Conditional knockout systems:
Implement inducible promoter systems (tetracycline-responsive)
Create temperature-sensitive alleles
Develop degron-tagged versions of PM0682 for controlled protein degradation
Phenotypic characterization of knockouts:
Growth curves under various conditions
Virulence assessment in cellular and animal models
Transcriptomic and proteomic profiling to identify affected pathways
Complementation studies to confirm phenotype specificity
Special considerations for P. multocida include:
Low transformation efficiency requiring optimization of electroporation parameters
Limited genetic tools compared to model organisms
Potential essentiality of the gene requiring conditional approaches
Capsule interference with transformation requiring acapsular strains for initial method development
This approach allows researchers to definitively link PM0682 to specific phenotypes and determine whether it plays roles in key virulence mechanisms similar to other P. multocida proteins that regulate capsule synthesis, LPS production, and iron utilization .
Transcriptomic analyses provide valuable insights into the regulatory networks involving PM0682:
RNA-Seq experimental design:
Compare wild-type vs. PM0682 knockout strains
Analyze expression under various conditions (nutrient limitation, host-mimicking environments)
Include time-course experiments to capture dynamic responses
Compare transcriptomes across different growth phases
Data analysis pipeline:
Quality control and read mapping to P. multocida genome
Differential expression analysis with appropriate statistical thresholds
Pathway and gene ontology enrichment analysis
Co-expression network construction
Integration with other omics data:
Correlate transcriptomic changes with proteomic alterations
Connect with metabolomic shifts to identify functional impacts
Integrate with ChIP-seq data if PM0682 is suspected to have DNA-binding properties
Validation experiments:
qRT-PCR validation of key differentially expressed genes
Reporter gene assays for promoter activity analysis
Electrophoretic mobility shift assays (EMSA) if DNA-binding is suspected
This approach can reveal whether PM0682 functions in regulatory networks, potentially identifying co-regulated genes and biological processes affected by PM0682 expression. It may also provide insights into whether PM0682 is involved in stress responses, virulence regulation, or metabolic pathways in P. multocida .
Structural characterization of PM0682 requires a multi-technique approach to overcome challenges associated with uncharacterized proteins:
X-ray crystallography workflow:
Optimize expression and purification for high protein homogeneity
Perform crystallization screening (sparse matrix, grid screens)
Optimize crystallization conditions for diffraction-quality crystals
Data collection at synchrotron facilities
Structure solution by molecular replacement or experimental phasing
Model building, refinement, and validation
NMR spectroscopy approach:
Express isotopically labeled protein (15N, 13C)
Acquire multidimensional NMR spectra (HSQC, NOESY, TOCSY)
Assign backbone and side-chain resonances
Calculate solution structure using distance restraints
Analyze dynamics and potential ligand interactions
Cryo-electron microscopy:
Particularly useful if PM0682 forms larger complexes
Sample preparation on grids and vitrification
Data collection and processing
3D reconstruction and model building
Complementary biophysical techniques:
Circular dichroism for secondary structure assessment
Small-angle X-ray scattering (SAXS) for solution shape
Hydrogen-deuterium exchange mass spectrometry for dynamics and interactions
Computational structure prediction integration:
Compare experimental structures with AlphaFold predictions
Use computational models to guide experimental design
Molecular dynamics simulations to explore conformational space
Structural information would provide crucial insights into potential functional sites, interaction surfaces, and evolutionary relationships of PM0682, potentially revealing its role in P. multocida pathogenesis .
Investigating PM0682's potential role in antimicrobial resistance requires a comprehensive approach:
Comparative susceptibility testing:
Determine Minimum Inhibitory Concentrations (MICs) for wild-type vs. PM0682 knockout strains
Test against clinically relevant antibiotics (penicillins, tetracyclines, fluoroquinolones)
Analyze changes in resistance profiles under different growth conditions
Include β-lactamase activity assays to detect potential enzymatic resistance mechanisms
Gene expression analysis:
Examine PM0682 expression changes in response to antibiotic exposure
Monitor expression of known resistance genes in PM0682 mutants
Perform RNA-Seq to identify global transcriptional changes affecting resistance
Functional characterization:
Test for direct antibiotic binding or modification using purified recombinant PM0682
Examine membrane permeability changes in PM0682 mutants
Investigate efflux pump activity differences between wild-type and mutant strains
Genetic complementation and overexpression studies:
Restore wild-type PM0682 expression in knockout strains to confirm phenotype
Overexpress PM0682 to assess if increased expression enhances resistance
Introduce PM0682 into heterologous hosts to test transferability of resistance phenotypes
Clinical isolate correlation studies:
Survey PM0682 sequence variations across clinical isolates with different resistance profiles
Correlate gene expression levels with resistance patterns
Identify potential mutations associated with resistance development
This systematic approach would determine whether PM0682 contributes to the reported phenomenon of antibiotic resistance in P. multocida, particularly given that penicillin-resistant strains have been reported and β-lactamase positivity was found in 16 percent of infected individuals .