Recombinant Pasteurella multocida Uncharacterized protein PM0739 (PM0739)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
PM0739; Uncharacterized protein PM0739
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM0739
Target Protein Sequence
MSLRQAILPACLNNTGDSMAIVTNTPIWVWCVLLCLLYVGSKQSKTRQIKPYKLTFLPLI FLPIVIMSIMQSHHPLIAGFGFIVGLALGLFFRVDNLEGCPFVTKTRATVDTKRKLSSAY PVLIHFYF
Uniprot No.

Target Background

Database Links

KEGG: pmu:PM0739

STRING: 272843.PM0739

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida and why is PM0739 significant for research?

Pasteurella multocida is a Gram-negative, nonmotile, penicillin-sensitive coccobacillus classified into five serogroups (A, B, D, E, F) based on capsular composition and 16 somatic serovars (1-16). This bacterium causes diverse diseases including fowl cholera in poultry, atrophic rhinitis in pigs, and hemorrhagic septicemia in cattle and buffalo . It also causes zoonotic infections in humans, typically resulting from domestic pet bites or scratches .

PM0739 represents one of several uncharacterized proteins in the P. multocida genome. Studying such proteins is critical because they may play essential roles in bacterial pathogenesis, survival, or antibiotic resistance. Uncharacterized proteins like PM0739 potentially offer novel insights into bacterial biology and represent untapped targets for therapeutic interventions.

What are the primary approaches for initial characterization of PM0739?

Initial characterization of PM0739 should follow a systematic approach combining computational and experimental methods:

Characterization ApproachMethodologyExpected Outcomes
Sequence AnalysisBLAST, Multiple Sequence AlignmentEvolutionary relationships, Conserved domains
Structural PredictionHomology modeling, Ab initio modeling3D structure prediction, Functional domains
Physicochemical AnalysisProtParam, ProtScaleMolecular weight, pI, stability indices
Subcellular LocalizationPSORT, SignalP, TMHMMCellular compartment prediction, Membrane topology
Functional AnnotationInterProScan, Pfam, SMARTDomain identification, Functional predictions

When approaching uncharacterized proteins, researchers should employ a systematic workflow that begins with in silico analysis before proceeding to experimental validation . The characterization process should integrate both genomic and proteomic approaches to develop comprehensive functional hypotheses.

What expression systems are recommended for recombinant production of PM0739?

For optimal recombinant expression of PM0739, several expression systems can be employed based on experimental requirements:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, Rapid growth, Cost-effectiveLimited post-translational modificationsInitial characterization, Antibody production
YeastGood protein folding, Some post-translational modificationsModerate yieldFunctional studies requiring proper folding
BaculovirusAdvanced post-translational modifications, High expressionComplex setup, Higher costStructural studies, Activity assays
Mammalian CellNative-like modifications, Proper foldingLowest yield, Most expensiveInteraction studies, Therapeutic applications

The source system should be selected based on research objectives . For basic structural studies, E. coli expression may be sufficient, while functional assays might require yeast or insect cell systems that better facilitate proper protein folding and modification.

How can integrative mixed methods enhance PM0739 characterization?

Implementing an Integrative Mixed Methods (IMM) approach for PM0739 characterization allows researchers to combine qualitative and quantitative methodologies in a unified analytical framework. This approach offers significant advantages over sequential or separate analyses:

The IMM paradigm involves six key stages:

  • Parallelism in study development

  • Evidence gathering

  • Processing/conversion

  • Data analyses

  • Interpretation

  • Integration

This methodology enables concurrent analysis of diverse data types, allowing researchers to transform qualitative thematic categories into numeric thematic variables through systematic coding processes . For PM0739 research, this might involve integrating structural predictions, experimental binding assays, and transcriptomic data to develop comprehensive functional models.

The value of this approach lies in its ability to recontextualize quantitative findings within their original qualitative context, enabling richer interpretation of results and more robust hypothesis development .

What computational approaches are most effective for predicting PM0739 function?

Functional prediction for uncharacterized proteins like PM0739 requires sophisticated computational strategies that extend beyond basic homology searches:

Computational ApproachImplementation MethodsApplications for PM0739
Conserved Domain AnalysisCDD, InterPro, PfamIdentification of functional motifs and domain architecture
Structural Homology ModelingI-TASSER, AlphaFold2, SWISS-MODELPrediction of tertiary structure to inform function
Binding Site PredictionFTSite, COACH, CastPIdentification of potential ligand binding regions
Molecular Dynamics SimulationGROMACS, AMBER, NAMDAnalysis of conformational dynamics and stability
Protein-Protein Interaction NetworksSTRING, PSICQUICPrediction of functional associations
Genomic Context AnalysisOperon structure, Phylogenetic profilingIdentification of functional relationships

For uncharacterized proteins, a coherent approach involving several computational tools is necessary . This includes determining conserved domains, subcellular localization, secretory nature, and physicochemical properties, along with comparative homology analysis . These methods collectively provide robust predictions that guide subsequent experimental validation.

What experimental design is optimal for determining PM0739's role in pathogenesis?

To systematically investigate PM0739's role in pathogenesis, a comprehensive experimental design should include:

  • Gene Knockout and Complementation Studies:

    • Create PM0739 deletion mutants

    • Perform complementation with wild-type PM0739

    • Compare virulence phenotypes in appropriate infection models

  • Protein Interaction Studies:

    • Pull-down assays to identify binding partners

    • Yeast two-hybrid screening

    • Co-immunoprecipitation coupled with mass spectrometry

  • Host Response Analysis:

    • Transcriptomic profiling of host cells exposed to wild-type vs. PM0739-deficient bacteria

    • Cytokine production measurement

    • Pathology comparison in animal models

  • Quasi-experimental Study Approaches:

    • Implement removed-treatment design (O₁ X O₂ O₃ removeX O₄) to assess causality

    • Compare results across multiple experimental conditions

    • Validate findings using repeated-treatment design (O₁ X O₂ removeX O₃ X O₄)

This multi-faceted experimental approach enables researchers to establish causal relationships between PM0739 and virulence phenotypes while providing mechanistic insights into its function.

What methods are recommended for structural analysis of PM0739?

Structural analysis of PM0739 requires a multi-technique approach:

For uncharacterized proteins like PM0739, structural analysis should begin with computational predictions to inform experimental approaches . The amino acid sequence (aa 1-128) suggests a relatively small protein amenable to NMR studies, while X-ray crystallography would provide higher resolution if crystallization is successful.

How can protein-protein interactions involving PM0739 be effectively studied?

Studying protein-protein interactions (PPIs) involving PM0739 requires a combination of computational predictions and experimental validation:

  • Computational PPI Prediction:

    • Sequence-based methods (conserved motifs, interaction domains)

    • Structure-based docking simulations

    • Genomic context analysis (gene neighborhood, co-expression patterns)

  • In Vitro Validation Methods:

    • Surface Plasmon Resonance (SPR) for binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) for binding under native-like conditions

  • Cellular Validation Approaches:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • Proximity Ligation Assay (PLA)

  • Proteome-wide Screening:

    • Tandem Affinity Purification coupled with Mass Spectrometry (TAP-MS)

    • Cross-linking Mass Spectrometry (XL-MS)

    • Protein microarrays

These approaches should be implemented within an integrative framework that allows concurrent analysis of multiple data types, following the IMM paradigm of parallelism in study development .

What is the potential of PM0739 as a vaccine target against Pasteurella multocida infections?

Evaluating PM0739 as a vaccine target requires assessment of several key criteria:

Evaluation CriteriaAssessment MethodsConsiderations for PM0739
Conservation Across StrainsComparative genomics, Sequence analysisDetermine presence and sequence conservation in different P. multocida isolates
ImmunogenicityELISpot, ELISA, Flow cytometryMeasure antibody responses and T-cell activation
AccessibilitySurface localization prediction, Antibody accessibilityDetermine if protein is exposed for immune recognition
Protective EfficacyChallenge studies in animal modelsEvaluate protection against different serotypes
Adjuvant RequirementsComparative formulation studiesDetermine optimal delivery system

P. multocida causes significant diseases in livestock, including hemorrhagic septicemia in cattle and buffalo, making effective vaccines economically important . As an uncharacterized protein, PM0739 represents a novel target that might elicit protective immunity not addressed by current vaccines.

For uncharacterized proteins, computational approaches can predict vaccine target properties through comparative homology analysis, allergenicity assessment, and antigenicity determination . These predictions guide experimental validation to establish PM0739's vaccine potential.

How can in vitro and in vivo models be optimized for studying PM0739 function?

Optimizing experimental models for PM0739 functional studies requires careful consideration of relevance and reproducibility:

  • In Vitro Models:

    • Cell types: Select cell lines representing relevant host tissues (respiratory epithelium, immune cells)

    • Culture conditions: Establish physiologically relevant oxygen levels, pH, and nutrient availability

    • Infection parameters: Determine optimal bacterial concentrations and incubation times

    • Readouts: Identify specific cellular responses (cytokine production, cytotoxicity, adhesion)

  • In Vivo Models:

    • Species selection: Choose models that recapitulate natural infection (mice, chickens, cattle)

    • Infection route: Mimic natural infection processes (intranasal, intratracheal)

    • Mutation strategies: Generate clean deletion mutants with minimal polar effects

    • Assessment parameters: Monitor colonization, inflammatory responses, and pathology

  • Ex Vivo Systems:

    • Tissue explants: Maintain organ architecture while allowing controlled experiments

    • Organoids: Develop 3D culture systems representing target tissues

    • Perfusion systems: Maintain tissue viability for extended studies

Quasi-experimental approaches can strengthen causal inference in these models. The removed-treatment design, which adds a third posttest measurement (O₃) followed by intervention removal before a final measurement (O₄), allows testing hypotheses about outcomes in both the presence and absence of intervention .

What challenges exist in differentiating the functions of PM0739 from similar uncharacterized proteins?

Differentiating the specific functions of PM0739 from other uncharacterized proteins presents several methodological challenges:

ChallengeMethodological SolutionsImplementation Strategies
Sequence Similarity ConfusionTargeted MutagenesisModify specific residues unique to PM0739 to distinguish function
Functional RedundancyMultiple Knockout StudiesCreate combinatorial deletions to identify compensatory mechanisms
Cross-reactivity of AntibodiesEpitope MappingDevelop highly specific antibodies targeting unique regions
Overlapping Binding PartnersCompetitive Binding AssaysPerform differential binding studies with purified proteins
Similar Domain ArchitectureDomain Swapping ExperimentsCreate chimeric proteins to isolate domain-specific functions

Robust experimental design is crucial when studying proteins with potential redundant functions. The one-group pretest-posttest design using a nonequivalent dependent variable can help differentiate specific effects of PM0739 from general effects on bacterial physiology .

How can contradictory data regarding PM0739 function be reconciled?

When faced with contradictory experimental results regarding PM0739 function, researchers should implement a systematic reconciliation approach:

  • Data Quality Assessment:

    • Reevaluate experimental controls and technical replicates

    • Examine statistical analyses for appropriate power and tests

    • Consider batch effects and experimental conditions

  • Methodological Integration:

    • Apply concurrent triangulation design to compare qualitative and quantitative data

    • Utilize parallelism in study design for integrated analysis

    • Implement unified conceptualization of information as research evidence

  • Context-Dependent Function Hypothesis:

    • Investigate condition-specific effects (pH, temperature, growth phase)

    • Examine strain-specific variations in protein sequence or expression

    • Consider host cell type or tissue specificity

  • Resolution Strategies:

    • Design critical experiments that directly address contradictions

    • Employ multiple complementary techniques to validate findings

    • Consider the removed-treatment design (O₁ X O₂ O₃ removeX O₄) to test causality

Contradictory results often arise from context-dependent protein functions or methodological differences. The IMM approach facilitates recontextualization of statistical results back to their original qualitative context, enabling rich interpretation of quantitatively derived outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.