Recombinant Pasteurella multocida Uncharacterized protein PM1101 (PM1101)

What is the basic structure and composition of PM1101 protein?

PM1101 is a full-length protein (126 amino acids) from Pasteurella multocida with the amino acid sequence: MLVINMKEDLERALKNKEPSFIIKGELAEKMKKAQRITTIDKWILGALAFVFAVSFFPSTSDGLFGIIMNKILIAIGIFATFEIAIILAVILGGMTLAMMLYKNYHAEFGTDVKTEKITIKCTIKK. The protein has been successfully expressed with an N-terminal His-tag in E. coli expression systems. Based on sequence analysis, PM1101 appears to contain transmembrane domains, suggesting it may be a membrane-associated protein, though its precise function remains uncharacterized .

What is known about the taxonomic context of PM1101 within Pasteurellaceae?

PM1101 is derived from Pasteurella multocida, which belongs to the Pasteurellaceae family. This family has undergone significant taxonomic reclassification in recent years, with many species being reclassified into genera such as Aggregatibacter, Avibacterium, and Gallibacterium based on 16S rRNA phylogenetic analysis. Understanding this taxonomic context is essential for comparative genomic studies involving PM1101, particularly when searching for homologous proteins in related species . Researchers should consider the evolving taxonomy when conducting phylogenetic analyses, as further reclassification may occur as more genomic data becomes available.

How does PM1101 relate to the pathogenicity of Pasteurella multocida?

While the specific function of PM1101 in pathogenicity hasn't been fully characterized, Pasteurella multocida is known to cause various diseases in animals, including pneumonia, atrophic rhinitis, hemorrhagic septicemia, and fowl cholera. In humans, it can cause zoonotic infections primarily through animal bites or scratches . The uncharacterized nature of PM1101 makes it a potentially interesting target for studying virulence mechanisms in P. multocida. Researchers investigating PM1101's role in pathogenicity should consider experimental approaches that examine protein expression during different stages of infection, interaction with host cells, and potential involvement in known virulence pathways of Pasteurellaceae.

What expression systems are optimal for recombinant PM1101 production?

The recombinant PM1101 protein has been successfully expressed in E. coli systems with an N-terminal His-tag . For optimal expression, researchers should consider the following methodological approach:

• Use an E. coli strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

• Employ a vector with a controllable promoter like T7 or tac

• Consider accessibility of translation initiation sites, as this significantly impacts expression success

• Optimize codon usage for E. coli if necessary - about 50% of recombinant proteins fail to express properly in host cells

Researchers may improve expression by using tools like TIsigner to modify the first nine codons with synonymous substitutions to enhance translation initiation site accessibility . This approach can significantly improve expression yields without altering the protein sequence.

What purification approaches are most effective for obtaining high-purity PM1101?

Given the His-tagged nature of the recombinant PM1101, immobilized metal affinity chromatography (IMAC) is the primary purification method. The methodological workflow should include:

• Initial lysis in a Tris/PBS-based buffer

• IMAC purification using Ni-NTA or similar resin

• Buffer exchange to remove imidazole

• Size exclusion chromatography for higher purity

• Quality control by SDS-PAGE (>90% purity should be achievable)

For membrane-associated proteins like PM1101, consider adding mild detergents (0.1% DDM or CHAPS) to maintain solubility during purification. The final product should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

How can researchers optimize storage conditions to maintain PM1101 activity?

The recombinant PM1101 protein's stability is maximized through proper storage conditions. The protein should be stored as follows:

• Short-term storage: Aliquots at 4°C for up to one week

• Long-term storage: Store at -20°C/-80°C with 5-50% glycerol (recommended final concentration of 50%)

• Avoid repeated freeze-thaw cycles as they significantly reduce protein stability

When reconstituting lyophilized protein, researchers should briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. The reconstituted protein should be aliquoted immediately to avoid repeated freeze-thaw cycles. These methodological precautions are critical for maintaining structural integrity and functional activity for downstream experiments.

How can principles of experimental design be applied to research involving PM1101?

When designing experiments with PM1101, researchers should consider principles of optimal experimental design to maximize information gain while minimizing resources. Key methodological considerations include:

• Use prior information from initial experiments to inform subsequent experimental designs

• Consider sequential design processes for parameter estimation experiments

• Employ utility functions to select optimal experimental conditions

• Use grid search or other optimization methods to identify optimal design points

For example, when investigating binding partners or functional characteristics of PM1101, researchers might first perform a small-scale exploratory experiment (n≈20 samples), then use this information to design more focused experiments with optimized conditions. This approach can substantially reduce the total number of experiments needed while maintaining or improving precision in parameter estimates .

What are the methodological approaches for analyzing PM1101 interactions with host cells?

Investigating potential interactions between PM1101 and host cells requires multiple complementary approaches:

• Pull-down assays: Use purified His-tagged PM1101 as bait to identify potential binding partners from host cell lysates

• Immunofluorescence microscopy: Examine co-localization of PM1101 with cellular structures

• Surface plasmon resonance: Quantify binding kinetics with suspected interaction partners

• Cell infection models: Compare wild-type P. multocida with PM1101 knockout strains

When designing these experiments, consider using targeted experimental design approaches rather than exhaustive screening. By selecting optimal conditions based on prior information, researchers can significantly reduce experimental burden while maintaining statistical power to detect meaningful interactions .

How can big data approaches enhance PM1101 functional characterization?

Given PM1101's uncharacterized status, researchers may benefit from big data approaches to generate hypotheses about its function. Consider the following methodological framework:

• Perform comparative genomics across Pasteurellaceae to identify conserved domains

• Use subsetting techniques to manage large-scale -omics datasets

• Apply principled design approaches to select representative subsets of data

• Employ sequential Monte Carlo algorithms for parameter estimation

When analyzing large datasets, researchers should consider using utility-based subsetting rather than random sampling. As demonstrated in comparative studies, the utility-based approach can achieve comparable precision with approximately half the sample size required by random sampling . This is particularly valuable when working with computationally intensive analyses of structural or functional genomics data.

What approaches can elucidate the function of the uncharacterized PM1101 protein?

Elucidating the function of PM1101 requires an integrated multi-omics approach:

• Structural analysis: Perform structural prediction using AlphaFold or similar tools to identify potential functional domains

• Comparative genomics: Identify homologs in related species with known functions

• Transcriptomics: Analyze expression patterns under different conditions

• Knockout studies: Generate PM1101 deletion mutants and assess phenotypic changes

• Interactome analysis: Identify protein-protein interactions using techniques like BioID or proximity labeling

When designing these studies, researchers should employ a sequential approach, using results from initial experiments to guide subsequent investigations. This allows for more precise hypothesis formulation and experimental design optimization . For instance, if structural analysis suggests a potential membrane transport function, subsequent experiments could focus on transport assays rather than general phenotypic screening.

How can researchers enhance PM1101 expression through codon optimization?

Optimizing PM1101 expression requires consideration of translation initiation site accessibility. Research has shown that the accessibility of translation initiation sites modeled using mRNA base-unpairing across the Boltzmann's ensemble is a critical factor in expression success . Researchers should:

• Analyze the current mRNA sequence for translation initiation site accessibility

• Use tools like TIsigner to introduce synonymous substitutions in the first nine codons

• Evaluate multiple optimization algorithms, focusing on accessibility rather than just codon adaptation indices

• Consider the impact of modifications on mRNA secondary structure

Studies have demonstrated that optimizing accessibility through modest synonymous changes can significantly improve recombinant protein expression levels . This approach is particularly valuable for challenging proteins like PM1101 that may have membrane associations or structural features that complicate expression.

How might PM1101 contribute to P. multocida pathogenesis in different host species?

Investigating PM1101's potential role in pathogenesis requires considering the diverse host range of P. multocida:

• Compare PM1101 sequence conservation across P. multocida strains isolated from different host species

• Evaluate PM1101 expression during infection in different animal models

• Assess the impact of PM1101 deletion on virulence in multiple host systems

• Investigate potential interaction with host immune components

When designing cross-species studies, researchers should consider using principled experimental design approaches to select representative host systems and infection conditions, rather than exhaustive testing across all possible hosts . This approach allows for more efficient use of resources while still generating robust data on potential host-specific functions.

How can researchers overcome solubility challenges with recombinant PM1101?

The sequence analysis of PM1101 suggests potential membrane association, which may create solubility challenges. Researchers can employ these methodological strategies:

• Expression optimization:

  • Use specialized strains for membrane proteins

  • Lower induction temperature (16-20°C)

  • Reduce inducer concentration

  • Consider fusion partners like MBP or SUMO

• Solubilization approaches:

  • Test multiple detergents (DDM, CHAPS, Triton X-100)

  • Optimize detergent concentration

  • Consider amphipols or nanodiscs for downstream applications

• Refolding strategies (if necessary):

  • Gradual dialysis from denaturing conditions

  • On-column refolding during purification

  • Pulsed renaturation

The choice of approach should be guided by the intended downstream applications and required protein quality. For structural studies, more stringent purification and solubilization conditions may be necessary compared to functional assays .

What are the key considerations for designing experiments to identify PM1101 binding partners?

Identifying potential binding partners for an uncharacterized protein like PM1101 presents methodological challenges that can be addressed through careful experimental design:

• Sample preparation considerations:

  • Use multiple detergent conditions for membrane protein extraction

  • Consider crosslinking approaches to capture transient interactions

  • Prepare negative controls using non-relevant His-tagged proteins

• Analytical approach optimization:

  • Start with affinity-based methods (pull-down, co-IP)

  • Follow with more quantitative approaches (SPR, MST)

  • Confirm biological relevance through in vivo approaches

• Data analysis strategy:

  • Apply utility-based experimental design principles to maximize information gain

  • Use sequential experimentation to refine binding partner candidates

  • Consider Bayesian approaches to incorporate prior knowledge

When designing these experiments, researchers should focus on maximizing the information gained per experiment rather than simply maximizing the number of experiments performed. This approach allows for more efficient use of resources while maintaining statistical power.

How can contradictory results in PM1101 function studies be reconciled and analyzed?

Given the uncharacterized nature of PM1101, researchers may encounter contradictory results from different approaches. A systematic methodology for reconciling contradictions includes:

• Comprehensive documentation of experimental conditions:

  • Catalog key variables like expression system, purification method, and buffer conditions

  • Create standardized reporting templates for lab members

• Analytical approach to contradictions:

  • Apply formal contradiction analysis frameworks

  • Develop competing hypotheses that could explain discrepancies

  • Design critical experiments specifically to distinguish between hypotheses

• Integrated data analysis:

  • Use principled experimental design approaches to select optimal experimental conditions

  • Apply Bayesian updating to incorporate new information systematically

  • Consider simulation studies to test sensitivity to experimental variables

When facing contradictory results, researchers should resist the temptation to simply discard outliers or unexpected findings. Instead, these discrepancies often provide valuable insights into protein behavior under different conditions and may help elucidate the true function of this uncharacterized protein.

What statistical approaches are most appropriate for analyzing PM1101 experimental data?

When analyzing experimental data related to PM1101, researchers should consider:

• Design-based statistical approaches:

  • Account for experimental design factors in statistical models

  • Use information-theoretic criteria for model selection

  • Consider utility-based design principles for follow-up experiments

• Specialized analyses for different experiment types:

  • Binding studies: Apply appropriate binding models (single-site, multiple-site)

  • Expression optimization: Consider non-linear relationships between factors

  • Functional assays: Use appropriate transformations to meet statistical assumptions

• Data integration approaches:

  • Develop frameworks to combine data from multiple experimental types

  • Consider Bayesian approaches to update knowledge systematically

  • Use meta-analysis techniques when combining results across studies

Researchers should be aware that traditional statistical approaches may not be optimal for data from designed experiments. Methods that explicitly account for the design structure often provide more accurate parameter estimates and increased statistical power .

How can researchers interpret PM1101 expression variability across different conditions?

Interpreting variability in PM1101 expression requires consideration of multiple factors:

When analyzing expression variability, researchers should consider using stochastic simulation models to better understand the relationship between translation initiation site accessibility, protein production, and cell growth . This approach provides a mechanistic framework for interpreting seemingly contradictory results across different expression conditions.