Recombinant Pasteurella multocida Uncharacterized protein PM1189 (PM1189)

Shipped with Ice Packs
In Stock

Description

Production and Purification

PM1189 is produced recombinantly in E. coli or yeast systems, followed by affinity chromatography for His-tagged purification. Critical parameters include:

  • Storage: Lyophilized powder stable at -20°C/-80°C. Reconstitution in Tris/PBS buffer with 6% trehalose (pH 8.0) is recommended .

  • Reconstitution: Solubilize in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol to prevent aggregation .

Comparative Production Systems

ParameterE. coli Expression Yeast Expression
Protein LengthFull-length (1–156 aa)Partial (undisclosed region)
TagHis-tagHis-tag (varies by construct)
YieldHighModerate

Research Applications

While PM1189's biological role is unclear, its homologs in P. multocida provide clues to potential applications:

A. Vaccine Development

  • Antigenic Potential: Recombinant PM1189 may serve as a subunit vaccine candidate, analogous to other P. multocida outer membrane proteins (e.g., PlpE, OmpH) that elicit protective immunity in ducks .

  • Adjuvant Compatibility: His-tagged PM1189 could be formulated with oil-based adjuvants, similar to multi-epitope vaccines like rPMT, which showed 57.1% survival in mice .

B. Pathogenicity Studies

  • Virulence Association: PM1189 may regulate adhesion or immune evasion mechanisms, akin to Pm0442, which modulates capsular polysaccharide synthesis and Toll-like receptor 2 (TLR2) signaling .

  • Transcriptional Regulation: Downstream genes affected by PM1189 could include LPS biosynthesis (lpxD, galE) or iron-uptake pathways .

Functional and Pathway Gaps

  • Cell envelope biogenesis (common in Gram-negative bacteria).

  • Nutrient transport (e.g., iron acquisition systems critical for P. multocida survival) .

Future Directions

  • Functional Characterization: Knockout studies to assess PM1189's role in bacterial adhesion, biofilm formation, or host immune modulation.

  • Multi-Antigen Vaccines: Combine PM1189 with established antigens (e.g., PlpE, OmpH) to enhance cross-protection against multiple P. multocida serotypes .

  • Structural Biology: X-ray crystallography or cryo-EM to resolve PM1189's 3D structure and ligand-binding sites.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag if possible.
Synonyms
PM1189; Uncharacterized protein PM1189
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM1189
Target Protein Sequence
MTEKRLAQISVVLSTIIIMTYAFLSSYFLNKPLNLSSADLMYFALSNLLSLSLPFVCAWF PYLFVRPAAVTGSALSAFGLFLFFAITSSTMDDPKGAAAIWVIYFFWLIGAALAGVYPAL FKPHFFTKTATRALVLSALFTVVVSFIIGFLISRIA
Uniprot No.

Target Background

Database Links

KEGG: pmu:PM1189

STRING: 272843.PM1189

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Pasteurella multocida Uncharacterized Protein PM1189?

PM1189 is a full-length protein (156 amino acids) from Pasteurella multocida that remains functionally uncharacterized. Available as a recombinant protein expressed in E. coli with an N-terminal His-tag (UniProt ID: Q9CLN1), it represents one of many bacterial proteins whose functions remain to be elucidated. Current research aims to determine its structural characteristics and biological role within P. multocida .

What are the optimal storage conditions for recombinant PM1189?

Recombinant PM1189 requires specific storage conditions to maintain stability:

Storage ParameterRecommended ConditionNotes
FormLyophilized powderAs supplied
Long-term storage-20°C to -80°CUpon receipt
Working storage4°CFor up to one week
BufferTris/PBS-based, pH 8.0 with 6% TrehaloseStorage buffer
AliquotingRequiredAvoid repeated freeze-thaw cycles

For long-term stability, reconstituted protein should be supplemented with glycerol (typically to a final concentration of 50%) before storing at -20°C/-80°C in multiple aliquots .

What is the recommended reconstitution protocol for PM1189?

For optimal reconstitution of PM1189:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (standard is 50%)

  • Create working aliquots to minimize freeze-thaw cycles

  • Use reconstituted protein within established stability timeframes

How should proteomics experiments be designed for studying uncharacterized proteins like PM1189?

When designing proteomics experiments for uncharacterized proteins like PM1189, researchers should consider the following optimization strategy based on simulation studies:

Experimental ParameterOptimal ApproachImpact on Success Rate
Protein separationImplement before improving MS parametersSignificant improvement in success rate
MS detection limitImprove after protein separationEnhances detection of low-abundance proteins
MS dynamic rangeEnhance after improving detection limitIncreases relative dynamic range
Sample loading>0.1 μg of peptide materialDirectly affects detection sensitivity
Peptide fractionation>100 fractions for complex samplesImproves separation and detection

Simulation studies demonstrate that improving protein separation before enhancing MS parameters yields better results than improving MS dynamic range first. The success rate (percentage of proteome detected) and relative dynamic range (depth of detection for low-abundance proteins) can increase dramatically with proper experimental design .

What analytical challenges should researchers anticipate when working with PM1189?

Researchers working with uncharacterized proteins like PM1189 should prepare for several analytical challenges:

  • Low abundance issues: If PM1189 is not highly expressed, detection may require enrichment strategies

  • Membrane association complications: The hydrophobic regions suggest potential membrane association, which complicates extraction and analysis

  • Functional ambiguity: Without known functional motifs, targeted assays must be designed based on preliminary predictions

  • Structural determination: The absence of structural homologs with high sequence identity (>30%) may limit the accuracy of homology modeling approaches

What computational methods are most effective for predicting the function of PM1189?

A multi-faceted computational approach has demonstrated high efficacy (98% accuracy) for functional annotation of hypothetical proteins:

ApproachKey ToolsApplication to PM1189
Sequence-based analysisPfam, InterPro, CDD-BLAST, SCANPROSITEIdentify protein families, domains, and functional sites
Structure predictionSWISS-MODEL, CATH, SUPERFAMILYGenerate tertiary structure models and identify structural homologs
Protein-protein interactionsSTRING databasePredict functional associations with known proteins
Subcellular localizationVarious prediction algorithmsDetermine likely cellular location (membrane, cytoplasm, etc.)

This integrated approach has been successfully applied to annotate hypothetical proteins in various bacterial species, including identifying proteins involved in adaptation to unfavorable environments and those with biotechnological potential .

How can tertiary structure prediction contribute to functional annotation of PM1189?

Tertiary structure prediction represents a powerful approach for functional annotation of uncharacterized proteins:

  • Homology modeling using SWISS-MODEL can generate structural models if templates with >30% sequence identity are available

  • Quality assessment using Ramachandran plots and structural validation scores helps determine model reliability

  • Structural comparison based on the Needleman-Wunsch algorithm can identify structural similarities even when sequence similarity is low

  • Identification of potential binding pockets or active sites can suggest functional roles

These approaches have successfully attributed functions to previously uncharacterized proteins with accuracy rates approaching 98% when combined with other annotation methods .

How can experimental validation be designed to confirm computational predictions for PM1189?

Following computational prediction of potential functions, experimental validation should proceed systematically:

  • Expression validation:

    • Confirm expression under various growth conditions

    • Analyze expression patterns during stress or infection scenarios

  • Localization studies:

    • Use fluorescent protein fusions to determine subcellular localization

    • Perform subcellular fractionation followed by Western blotting

  • Interaction validation:

    • Conduct co-immunoprecipitation experiments with predicted interaction partners

    • Perform yeast two-hybrid or bacterial two-hybrid assays

  • Functional assays:

    • Design biochemical assays based on predicted functions

    • Perform gene knockout/complementation studies to observe phenotypic effects

This systematic approach has successfully validated computational predictions for numerous hypothetical proteins in bacterial systems .

What mass spectrometry parameters should be optimized for detecting and analyzing PM1189?

Optimization of mass spectrometry for studying PM1189 requires careful consideration of multiple parameters:

MS ParameterRecommended SettingRationale
Detection limitBetter than 1 fmolEnsures detection of low-abundance proteins
Dynamic range>100-foldCaptures proteins across varying abundance levels
Protein separationPrior to MS analysisReduces sample complexity
Peptide loading>0.1 μgImproves detection probability
Fractionation>100 fractions for complex samplesEnhances separation and identification

Simulations indicate that the sequential improvement of (1) protein separation, (2) MS detection limit, and (3) MS dynamic range provides optimal results for comprehensive protein analysis. This approach is particularly important for detecting proteins like PM1189 that may be expressed at low levels .

What potential biotechnological applications might PM1189 have based on similar uncharacterized proteins?

While the specific function of PM1189 remains unknown, research on other previously uncharacterized bacterial proteins suggests several potential applications:

  • Enzyme discovery: Many hypothetical proteins have been found to possess novel enzymatic activities valuable for industrial processes

  • Antimicrobial development: Membrane-associated proteins like PM1189 may represent targets for new antimicrobial compounds

  • Bioremediation: Some bacterial proteins with membrane association participate in transport or modification of environmental compounds

  • Biosynthetic pathways: Uncharacterized proteins have been found to participate in biosynthesis of antibiotics, coenzymes, and rare sugars

Similar annotation projects have identified hypothetical proteins involved in sporulation, biofilm formation, motility, and adaptation to unfavorable environments, suggesting PM1189 might have similar roles in P. multocida .

What is the recommended research workflow for characterizing PM1189?

Based on successful approaches used for other hypothetical proteins, the following workflow is recommended for PM1189 characterization:

  • Initial computational analysis:

    • Sequence analysis and homology searches

    • Structure prediction and analysis

    • Functional domain identification

    • Protein-protein interaction prediction

  • Recombinant protein production and purification:

    • Optimize expression in E. coli or alternative systems

    • Purify using His-tag affinity chromatography

    • Verify purity by SDS-PAGE (>90% recommended)

  • Structural studies:

    • Circular dichroism for secondary structure assessment

    • Crystallization trials or NMR studies if feasible

    • Validation of computational models

  • Functional studies:

    • Design assays based on computational predictions

    • Perform gene knockout studies in P. multocida

    • Conduct protein-protein interaction studies

This systematic workflow combines computational prediction with experimental validation, maximizing the probability of successful characterization .

What are the major limitations in studying uncharacterized proteins like PM1189?

Researchers should be aware of several significant limitations when studying PM1189 and similar uncharacterized proteins:

  • Computational prediction limitations:

    • Homology-based predictions depend on existing characterized homologs

    • Structural predictions become less reliable below 30% sequence identity

    • Protein-protein interaction predictions may yield false positives

  • Experimental challenges:

    • Expression and purification may be difficult if the protein is toxic to E. coli

    • Membrane-associated proteins can be challenging to solubilize while maintaining function

    • Absence of known function complicates assay design

  • Validation hurdles:

    • Gene knockout may be lethal or produce no observable phenotype

    • Multiple redundant functions may mask the effect of single gene manipulation

    • Specialized growth conditions may be required to observe function

Understanding these limitations is crucial for designing robust experimental approaches that can overcome these challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.