Recombinant Pasteurella multocida Uncharacterized protein PM1437 (PM1437)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you require a specific format, please specify your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for accurate delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
PM1437; Uncharacterized protein PM1437
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM1437
Target Protein Sequence
MERENKPKGFSGFSWGIALFCLPILLWPLALTISPNLLKNPRLSETETTLMSVFLWAYPF GLALIARLAYRLNQHKPPFARGLLGLSAVAFYGMLFYVAGGFH
Uniprot No.

Target Background

Database Links

KEGG: pmu:PM1437

STRING: 272843.PM1437

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida and what diseases does it cause?

Pasteurella multocida is a Gram-negative, nonmotile, penicillin-sensitive coccobacillus that serves as an important pathogenic bacterium in domestic animals and humans. The organism is currently classified into five capsular serogroups (A, B, D, E, and F) based on capsular composition and 16 somatic serovars (1-16) . It causes a range of diseases including fowl cholera in poultry, atrophic rhinitis in pigs, and bovine hemorrhagic septicemia in cattle and buffalo. In humans, it can cause zoonotic infections, typically resulting from bites or scratches from domestic pets . Many mammals, including domestic cats and dogs, harbor P. multocida as part of their normal respiratory microbiota .

What is PM1437 and how was it identified?

PM1437 is an uncharacterized protein from Pasteurella multocida strain Pm70 . Uncharacterized proteins like PM1437 are typically identified through genomic sequencing projects, but their specific functions remain unknown or poorly understood. The protein has been produced recombinantly for research purposes, with the specific amino acid sequence 1-103 available for experimental studies . Similar to other uncharacterized proteins, PM1437 likely underwent initial identification through genomic annotation followed by basic bioinformatic analysis to predict protein domains and potential functions.

What are the major virulence factors in Pasteurella multocida?

The virulence factors of P. multocida include:

Virulence Factor CategoryExamplesFunction
CapsuleHyaluronic acid, heparin, chondroitin (A-type)Resistance to phagocytosis, adherence
Lipopolysaccharide (LPS)Various LPS structuresEndotoxic activity, resistance to complement
Outer membrane proteinsVarious OMPsAdherence, nutrient acquisition
Iron utilization proteinsIron-regulated proteinsIron acquisition during infection
FimbriaeVarious adhesinsAttachment to host cells
ToxinsPasteurella multocida toxin (PMT)Cytotoxic effects

These virulence factors contribute to the pathogenesis of P. multocida infections . Research on other P. multocida proteins suggests that virulence factors like capsules are essential for pathogenesis, as acapsular mutants constructed from different serogroups showed strongly attenuated virulence in mice .

What expression systems are most suitable for producing recombinant PM1437?

Recombinant PM1437 can be produced using several expression systems:

Expression SystemAdvantagesLimitationsApplication
E. coliRapid growth, high yield, cost-effectiveMay lack proper post-translational modificationsStructural studies, antibody production
YeastEukaryotic system, some post-translational modificationsLonger production time than E. coliFunctional studies requiring modifications
BaculovirusComplex post-translational modificationsMore complex setup, longer production timeProtein interaction studies
Mammalian cellsNative-like modificationsMost complex, expensive, lower yieldStudies requiring authentic structure

What purification methods are recommended for recombinant PM1437?

The purification of recombinant PM1437 typically follows standard protein purification protocols. Based on methodologies used for similar P. multocida proteins, a recommended workflow includes:

  • Affinity chromatography using His-tag or other fusion tags

  • Desalting via spin columns (similar to Zeba™ Spin Desalting Columns used for PM0442)

  • Endotoxin removal using specialized kits (such as Toxin Eraser™)

  • Quality control testing for endotoxin contamination using LAL assays

  • Size exclusion chromatography for final polishing

It is critical to verify protein purity through SDS-PAGE and confirm proper folding through circular dichroism or other biophysical techniques before proceeding with functional studies.

How can researchers investigate the potential virulence role of PM1437?

Based on approaches used for other P. multocida proteins like Pm0442, a comprehensive strategy for investigating PM1437's potential role in virulence would include:

  • Gene expression analysis during infection: Compare PM1437 expression levels between in vitro growth and in vivo infection models to determine if the gene is up-regulated during infection, similar to how Pm0442 was found to be dramatically up-regulated in infected mice .

  • Gene knockout studies: Create a PM1437 deletion mutant (PM1437Δ) and compare its virulence characteristics with the wild-type strain through:

    • Bacterial load assessment in mouse lung tissue

    • Histopathological examination of infected tissues

    • Survival rate studies in animal models

    • Growth rate comparison in laboratory media

  • Complementation studies: Reintroduce the PM1437 gene to the mutant strain to confirm that observed phenotypic changes are specifically due to PM1437 deletion.

  • Protein interaction studies: Identify potential host receptors or binding partners through techniques such as pull-down assays, co-immunoprecipitation, or yeast two-hybrid screening.

What experimental approaches can help determine the subcellular localization of PM1437?

TechniqueApplication to PM1437Data Output
Cell fractionationSeparation of bacterial cellular componentsWestern blot showing protein distribution
Immunofluorescence microscopyVisualization of protein locationImages showing spatial distribution
Reporter gene fusionIn vivo tracking of protein localizationFluorescence patterns indicating location
Biotinylation assaysSurface exposure assessmentWestern blot of biotin-labeled proteins
Proteomic analysisMass spectrometry of cellular fractionsComprehensive protein identification

For PM1437, researchers should combine at least two complementary approaches to confirm localization results. If PM1437 is found in the outer membrane like Pm0442 , this would provide valuable clues about its potential role in host-pathogen interactions.

How might PM1437 interact with the host immune system based on studies of other P. multocida proteins?

Studies on the related protein Pm0442 have shown that P. multocida proteins can interact with host immune receptors like Toll-like receptor 2 (TLR2) to mediate pro-inflammatory cytokine secretion through activation of specific signaling pathways . Researchers investigating PM1437 should consider:

  • TLR binding assays: Test if recombinant PM1437 binds to TLR2 or other pattern recognition receptors using techniques such as ELISA or surface plasmon resonance.

  • Cytokine profiling: Measure secretion of pro-inflammatory cytokines (IL-1β, TNF-α, IL-6, IL-12p40) in macrophages exposed to purified PM1437.

  • Signaling pathway analysis: Examine activation of NF-κB, ERK1/2, and p38 pathways in cells treated with PM1437, similar to pathways activated by Pm0442 .

  • Inhibitor studies: Use specific inhibitors like BAY11-7082 (NF-κB inhibitor) to determine which signaling pathways are essential for PM1437-induced responses.

  • Immunization studies: Evaluate if recombinant PM1437 can induce protective immunity in animal models.

What bioinformatic approaches can predict the function of uncharacterized proteins like PM1437?

Bioinformatic ApproachApplication to PM1437Expected Outcome
Sequence homology analysisComparison with characterized proteinsPotential functional homologs
Domain predictionIdentification of conserved domainsPrediction of biochemical activity
Structural modeling3D structure predictionInsights into functional mechanisms
Genomic context analysisExamination of adjacent genesPotential operons or functional relationships
Phylogenetic profilingDistribution across bacterial speciesEvolutionary conservation patterns

For PM1437, researchers should particularly focus on comparative analysis with other Pasteurellaceae family proteins that have been functionally characterized. If PM1437 shows structural similarities to proteins like Pm0442, it might suggest roles in bacterial adhesion, capsule formation, or host immune response modulation .

How can structural biology techniques contribute to understanding PM1437's function?

A comprehensive structural biology approach would involve:

The structural data should be integrated with functional assays to establish structure-function relationships and potentially identify druggable targets if PM1437 proves to be a significant virulence factor.

How can findings from PM1437 research contribute to vaccine development against P. multocida?

Research on other P. multocida proteins has shown that mutant strains with deleted virulence factors can serve as potential vaccine candidates. For example, the PmCQ2Δ0442 mutant could provide 70-80% protection to mice challenged with wild-type PmCQ2 . For PM1437 research, consider:

  • PM1437 deletion mutant evaluation: Assess attenuation of virulence and potential as a live attenuated vaccine.

  • Recombinant PM1437 immunogenicity: Evaluate the immune response generated by vaccination with purified PM1437 protein.

  • Epitope mapping: Identify immunodominant regions that could be incorporated into subunit vaccines.

  • Adjuvant optimization: Test different adjuvant formulations to enhance immune responses to PM1437.

  • Cross-protection assessment: Evaluate if immunity against PM1437 provides protection against multiple serotypes of P. multocida.

What challenges exist in translating in vitro findings about PM1437 to in vivo function?

Researchers should be aware of several challenges when moving from in vitro to in vivo studies:

  • Expression conditions: PM1437 expression may be regulated differently in laboratory media versus host environments, similar to how Pm0442 is up-regulated during infection .

  • Protein interactions: In vitro studies may not capture the complex interactions between PM1437 and other bacterial or host proteins that occur in vivo.

  • Host-specific factors: PM1437 may function differently in various host species due to differences in receptors or immune responses.

  • Strain variations: Function may vary between different P. multocida strains or serotypes.

  • Technical limitations: Techniques used for protein characterization in vitro may not directly translate to functional importance during infection.

To address these challenges, researchers should employ multiple complementary approaches and validate findings across different experimental systems and bacterial strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.