Recombinant Pasteurella multocida Uncharacterized protein PM1478 (PM1478)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pasteurella multocida Uncharacterized Protein PM1478 (PM1478)

Recombinant Pasteurella multocida Uncharacterized protein PM1478 (PM1478) is a protein derived from the bacterium Pasteurella multocida . P. multocida is a Gram-negative bacterium known to cause various diseases in animals, including fowl cholera in poultry, atrophic rhinitis and pneumonia in pigs, and hemorrhagic septicemia in cattle and buffalo . PM1478 is a protein of unknown function found in P. multocida .

Recombinant PM1478 is produced using genetic engineering techniques, where the gene encoding PM1478 is inserted into a host organism (e.g., E. coli) to produce the protein in large quantities . The recombinant protein often includes a tag, such as a His-tag, to facilitate purification .

Characteristics

CharacteristicDescription
Full NameRecombinant Full Length Pasteurella multocida Uncharacterized Protein Pm1478(Pm1478) Protein, His-Tagged
SourcePasteurella multocida
HostE. coli
TagHis-Tag
Protein LengthFull Length (1-120 amino acids)
UniProt AccessionQ9CKX3
Amino Acid SequenceMKEFQFDTLWAVMQIMLGAFFWPALIVIILTIAAFCYLLIKEKGLVACRLKGSSLVGLLGGILALYLLFSISQASISDIGGPIDLILVVLAYFGGFLASTMLLYSIIGFVKPRSCACQKN
Molecular WeightThe purified recombinant PM1478 protein shows bands on SDS-polyacrylamide gels with expected molecular weights of 84.4 kDa, 94.8 kDa, and 96.7 kDa .
ApplicationsELISA, vaccine development, and research on Pasteurella multocida
StorageStore at -20℃; avoid repeated freezing and thawing; store working aliquots at 4℃ for up to one week .

Production

Recombinant PM1478 is produced by cloning the PM1478 gene from Pasteurella multocida into an expression vector, which is then transformed into E. coli cells . The E. coli cells are cultured to express the PM1478 protein, which is then purified using affinity chromatography, taking advantage of the His-tag .

Function and Role in Pasteurella multocida

The specific function of PM1478 in Pasteurella multocida is currently not well-defined . Research indicates that Pasteurella multocida employs various virulence factors to cause disease, including toxins, capsule polysaccharides, and lipopolysaccharides . Further studies are needed to elucidate the precise role of PM1478 in the bacterium's pathogenesis and its potential as a target for therapeutic interventions.

Immunogenicity and Vaccine Potential

Recombinant proteins from Pasteurella multocida, including outer membrane proteins, have demonstrated immunogenicity and protective efficacy in animal models . For instance, a multi-epitope recombinant antigen of Pasteurella multocida toxin (PMT) showed excellent immunogenicity and protection in mice, suggesting its potential as a subunit vaccine candidate . While there is no direct evidence of PM1478 being used as a vaccine, recombinant Pasteurella multocida proteins have been explored for their vaccine potential .

Genomic Context

The complete genome sequence of Pasteurella multocida isolates provides valuable information about the genetic makeup of the bacterium, including the presence of virulence genes and antibiotic resistance markers . Analysis of the genome can help identify and characterize proteins like PM1478, offering insights into their potential functions and roles in bacterial pathogenesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize fulfilling your request.
Synonyms
PM1478; Uncharacterized protein PM1478
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM1478
Target Protein Sequence
MKEFQFDTLWAVMQIMLGAFFWPALIVIILTIAAFCYLLIKEKGLVACRLKGSSLVGLLG GILALYLLFSISQASISDIGGPIDLILVVLAYFGGFLASTMLLYSIIGFVKPRSCACQKN
Uniprot No.

Target Background

Database Links

KEGG: pmu:PM1478

STRING: 272843.PM1478

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the PM1478 protein?

PM1478 is a 120-amino acid protein (full-length 1-120aa) from Pasteurella multocida with UniProt ID Q9CKX3. The amino acid sequence is: MKEFQFDTLWAVMQIMLGAFFWPALIVIILTIAAFCYLLIKEKGLVACRLKGSSLVGLLGGILALYLLFSISQASISDIGGPIDLILVVLAYFGGFLASTMLLYSIIGFVKPRSCACQKN. Analysis of its sequence suggests it is a membrane-associated protein with hydrophobic regions consistent with transmembrane domains. This is particularly evident in the N-terminal region that contains a stretch of hydrophobic residues (LWAVMQIMLGAFFWPALIVIILTIAAFCYL), suggesting a potential role in membrane integrity or transport functions .

How does PM1478 relate to other proteins within the Pasteurella multocida genome?

PM1478 is one of several uncharacterized proteins in the P. multocida genome. Like PM1437, it lacks definitive functional annotation but represents part of the core genome of this pathogen. Genomic context analysis reveals that PM1478 exists within a region containing genes involved in membrane structure and transport mechanisms. Comparative genomic studies across different P. multocida strains show that PM1478 is relatively conserved, suggesting it may serve an important function for bacterial survival or fitness .

What is the predicted cellular localization of PM1478?

Based on bioinformatic predictions from the amino acid sequence, PM1478 likely localizes to the bacterial membrane. The protein contains multiple hydrophobic regions characteristic of transmembrane domains, suggesting integration into either the inner or outer membrane. Subcellular fractionation studies followed by Western blot analysis using anti-His antibodies can experimentally validate this prediction. Understanding the cellular localization is critical for hypothesizing potential functions, as membrane proteins often play roles in nutrient acquisition, signaling, or host-pathogen interactions .

What expression systems are optimal for recombinant PM1478 production?

The recombinant PM1478 protein can be successfully expressed in E. coli with an N-terminal His-tag, which facilitates purification via affinity chromatography. For membrane proteins like PM1478, expression optimization may require testing multiple conditions:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid growthMay require codon optimization, potential for inclusion bodies
YeastBetter for eukaryotic-like post-translational modificationsLonger growth time, more complex media
BaculovirusSuperior folding for complex proteinsHigher cost, specialized expertise required
Mammalian cellBest for studying mammalian-relevant interactionsLowest yield, highest cost, longest production time

For initial characterization, E. coli-based expression is recommended due to its simplicity and yield, though consideration of alternative systems may be necessary if functional studies reveal issues with protein folding or activity .

What are the recommended storage and handling conditions for recombinant PM1478?

Recombinant PM1478 protein should be stored as a lyophilized powder at -20°C to -80°C for long-term stability. Upon reconstitution in deionized sterile water to 0.1-1.0 mg/mL, the addition of 5-50% glycerol (with 50% being optimal) helps prevent freeze-thaw damage. Aliquoting is essential to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity. Working aliquots can be stored at 4°C for up to one week. The protein's stability in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been validated, but alternative buffers may be tested if specific experimental conditions require it .

How can researchers validate the structural integrity of purified PM1478?

Multiple complementary techniques should be employed to validate the structural integrity of purified PM1478:

  • SDS-PAGE to confirm purity (>90%) and expected molecular weight

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Size exclusion chromatography to evaluate oligomeric state

  • Limited proteolysis to examine domain organization

  • Thermal shift assays to determine stability under various buffer conditions

For membrane proteins like PM1478, additional techniques such as detergent screening may be necessary to maintain native-like conformations. Western blotting using antibodies against the His-tag can confirm the identity of the purified protein, particularly when coupled with mass spectrometry for definitive identification .

How conserved is PM1478 across different Pasteurella multocida strains and serotypes?

Comparative genomic analysis reveals that PM1478 is relatively well-conserved across P. multocida strains, suggesting functional importance. Analysis of genome sequences from strains representing different host species, disease manifestations, and serotypes (A, B, D, E, F) shows varying degrees of sequence conservation. The highest conservation is observed in the transmembrane domains, while more variability exists in the loops connecting these domains. Using the RIRDC MLST (Multilocus Sequence Typing) scheme, researchers can correlate PM1478 sequence variations with specific sequence types, potentially linking genetic variants to virulence or host specificity. This conservation pattern suggests selective pressure to maintain certain structural features, indicative of a functional role in bacterial physiology or pathogenesis .

What phylogenetic insights can be gained from analyzing PM1478 across the Pasteurellaceae family?

Phylogenetic analysis of PM1478 homologs across the Pasteurellaceae family provides insights into evolutionary relationships and potential functional conservation. Alignment of PM1478 with homologs from related species such as Actinobacillus actinomycetemcomitans, Haemophilus influenzae, and other Pasteurellaceae members reveals conserved domains that likely serve critical functions. Constructing a phylogenetic tree based on these alignments can help determine whether PM1478 evolution follows species evolution or whether horizontal gene transfer events have occurred. Such analysis can also identify specific amino acid residues under positive or negative selection, providing clues about functionally important regions and evolutionary pressures .

How does understanding the genomic context of PM1478 contribute to functional hypotheses?

The genomic neighborhood of PM1478 provides valuable context for developing functional hypotheses. Analysis of adjacent genes, operon structure, and regulatory elements can reveal potential functional associations. If PM1478 is co-transcribed with genes of known function, it may participate in the same biological process. Additionally, identifying conserved gene clusters across multiple bacterial species can strengthen functional predictions through the principle of "guilt by association." Researchers should examine transcriptomic data to identify conditions under which PM1478 is co-expressed with genes of known function, potentially revealing regulatory networks and physiological responses in which this protein participates .

What bioinformatic approaches are most effective for predicting PM1478 function?

Given the uncharacterized nature of PM1478, a multi-faceted bioinformatic approach is essential for generating functional hypotheses:

  • Sequence-based predictions: Use tools like BLAST, HMMER, and protein family databases (Pfam, InterPro) to identify distant homologs with known functions.

  • Structural prediction: Employ AlphaFold2 or RoseTTAFold to generate a predicted three-dimensional structure, which can reveal potential binding sites or catalytic regions.

  • Domain architecture analysis: Identify conserved domains that might suggest specific biochemical functions.

  • Genomic context analysis: Examine neighboring genes, which often participate in similar pathways.

  • Co-expression network analysis: Identify genes with similar expression patterns across various conditions.

This integrated approach is particularly valuable for membrane proteins like PM1478, where experimental characterization can be challenging .

What experimental strategies can determine if PM1478 contributes to Pasteurella multocida virulence?

To assess PM1478's potential role in virulence, a systematic experimental approach is recommended:

  • Gene knockout/knockdown: Create a PM1478 deletion mutant and evaluate changes in virulence phenotypes in appropriate animal models.

  • Complementation studies: Restore the wild-type phenotype by reintroducing the gene to confirm phenotypic changes are directly attributable to PM1478.

  • Transcriptional analysis: Compare gene expression between wild-type and mutant strains during infection to identify affected pathways.

  • Host-pathogen interaction assays: Assess if the PM1478 mutant exhibits altered adhesion to host cells, resistance to phagocytosis, or survival within phagocytes.

  • In vivo competition assays: Co-infect hosts with wild-type and mutant strains to directly compare fitness during infection.

These approaches can determine whether PM1478 contributes to the various disease manifestations associated with P. multocida, including fowl cholera in poultry, hemorrhagic septicemia in cattle, and atrophic rhinitis in swine .

How can protein-protein interaction studies reveal PM1478's role in cellular processes?

Protein-protein interaction (PPI) studies can provide crucial insights into PM1478's functional networks:

  • Bacterial two-hybrid or yeast two-hybrid screening: Identify potential interaction partners, though modifications may be needed for membrane proteins.

  • Co-immunoprecipitation followed by mass spectrometry: Pull down PM1478 along with its interaction partners under various conditions.

  • Proximity labeling techniques (BioID or APEX2): Tag PM1478 with a proximity labeling enzyme to identify proteins in its vicinity within the cellular environment.

  • Cross-linking mass spectrometry: Use chemical cross-linkers to capture transient interactions followed by mass spectrometry identification.

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST): Validate and quantify specific interactions with candidate partners.

Integrating these results with transcriptomic and phenotypic data can place PM1478 within specific pathways or processes relevant to P. multocida physiology or pathogenesis .

How does PM1478 research contribute to understanding host-pathogen interactions in Pasteurella multocida infections?

Research on PM1478 can enhance our understanding of host-pathogen interactions by potentially revealing novel mechanisms of P. multocida adaptation to different host environments. If PM1478 is involved in membrane functions, it may contribute to resistance against host defense mechanisms, nutrient acquisition, or adhesion to host tissues. Comparative studies of PM1478 variants across strains isolated from different hosts (birds, cattle, swine, humans) could identify host-specific adaptations. Additionally, examining PM1478 expression during infection of different host cell types or tissues may reveal condition-specific functions related to pathogenesis. Since P. multocida causes zoonotic infections in humans, often resulting from animal bites or respiratory exposure, understanding PM1478's role may also have implications for human infections .

What role might PM1478 play in Pasteurella multocida's ability to survive in diverse host environments?

As a membrane protein, PM1478 may contribute to P. multocida's remarkable adaptability across diverse host species. The protein could be involved in:

  • Membrane permeability and homeostasis: Maintaining membrane integrity under varying environmental conditions.

  • Nutrient acquisition: Participating in transport systems for essential nutrients that vary between host environments.

  • Stress response: Mediating adaptation to host-specific stressors such as immune effectors or pH variations.

  • Biofilm formation: Contributing to bacterial community structure during colonization.

P. multocida infects a wide range of species from birds (causing fowl cholera) to mammals (causing hemorrhagic septicemia in cattle and atrophic rhinitis in swine), suggesting it possesses sophisticated adaptive mechanisms. PM1478's conservation across strains from different hosts, despite its uncharacterized nature, suggests it may play a role in this broad host range .

How can PM1478 research inform vaccine development against Pasteurella multocida infections?

Research on PM1478 has several potential implications for vaccine development:

  • Antigen evaluation: If PM1478 is surface-exposed and conserved across strains, it could represent a candidate antigen for subunit vaccines. Recombinant PM1478 protein can be evaluated for immunogenicity and protective efficacy.

  • Live attenuated vaccine development: If PM1478 contributes to virulence without being essential for growth, PM1478 mutants could serve as live attenuated vaccine candidates that maintain immunogenicity while exhibiting reduced pathogenicity.

  • Reverse vaccinology: Computational analysis of PM1478's structure and potential epitopes can inform epitope-based vaccine design strategies.

  • Cross-protective potential: If PM1478 is conserved across multiple serotypes of P. multocida, targeting it might provide cross-protection against diverse strains, addressing a major challenge in current vaccine development efforts.

Understanding PM1478's role in host-pathogen interactions could reveal whether antibodies against this protein would neutralize important virulence mechanisms, making it a valuable component of next-generation vaccines against economically important diseases like fowl cholera, hemorrhagic septicemia, and atrophic rhinitis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.