Recombinant Pasteurella multocida UPF0283 membrane protein PM0909 (PM0909)

Shipped with Ice Packs
In Stock

Description

Introduction

Pasteurella multocida is a bacterium known to cause a variety of diseases in animals, including fowl cholera in ducks . Research has focused on identifying and characterizing P. multocida proteins that could serve as potential vaccine candidates to combat these infections . One such protein is the Recombinant Pasteurella multocida UPF0283 membrane protein PM0909 (PM0909) .

General Information

Recombinant Pasteurella multocida UPF0283 membrane protein PM0909 (PM0909) is a protein derived from the Pasteurella multocida strain Pm70 . It is also referred to as UPF0283 membrane protein PM0909 . The protein is a full-length protein consisting of 358 amino acids .

Table 1: General Information for PM0909

FeatureDescription
Protein NameUPF0283 membrane protein PM0909
Gene NamePM0909
SpeciesPasteurella multocida (strain Pm70)
UniProt AccessionQ9CMC3
Amino Acid Length358
Expression Region1-358
Tag InfoDetermined during production process

Sequence

The amino acid sequence for the Recombinant Pasteurella multocida UPF0283 membrane protein PM0909 is :
MNEKRLFTEAQTENEAVDFTPKREFHGEMHIEKDEPVIEDRFVEQTFEHIVQPRSRWWKTGLALTALLFCFAVIAQSIQWLVDTWQQNQWIYFVFSLVTCLVVLLGVSSLGKEWLRLVKLKKRLSLQQKSQQILRESAVNLGQDFCAEKHQQIKALCTEMAQMLKLSSEDPGLIQWQNQLHDAYSAQEVAHLFSQTVLHPFDVQIKKLISKSALEAAVIVAVSPLAVIDMFFLSWRNIRLVNQIAQIYGIELGYWSRLRLLKMVLLNLAFAGATEVVQDIGLDWLSQDLTAKLSARAAQGIGVGLLTARLGIKAMEFCRPLAFQAGEKPRLNHIQQELLGQLRSTFFRSNKTKVKQQV

Immunogenicity and Protective Efficacy of Recombinant Proteins

Pasteurella multocida utilizes transmembrane proteins and lipoproteins to interact with the host, which makes them potential vaccine candidates . Research has been done on the recombinant forms of VacJ, PlpE, and OmpH proteins .

  • VacJ VacJ proteins are highly conserved among different serogroups and host species, showing 98.9%-99.3% homology .

  • PlpE The PlpE protein from type A:1 shows 87.6-94.7% homology but only 50% homology to porcine-derived D isolates .

  • OmpH OmpH is a major outer membrane protein associated with the pore protein family in P. multocida .

In one study, recombinant VacJ, PlpE, and OmpH proteins were tested for their immunogenicity and protective capabilities in ducks . The study revealed the following protection rates against P. multocida A: 1 challenge:

Table 2: Protection Rates of Recombinant Proteins

Vaccine GroupProtection Rate
rVacJ33.33%
rPlpE83.33%
rOmpH83.33%
rVacJ+rPlpE+rOmpH100%
Killed vaccine50%

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PM0909; UPF0283 membrane protein PM0909
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM0909
Target Protein Sequence
MNEKRLFTEAQTENEAVDFTPKREFHGEMHIEKDEPVIEDRFVEQTFEHIVQPRSRWWKT GLALTALLFCFAVIAQSIQWLVDTWQQNQWIYFVFSLVTCLVVLLGVSSLGKEWLRLVKL KKRLSLQQKSQQILRESAVNLGQDFCAEKHQQIKALCTEMAQMLKLSSEDPGLIQWQNQL HDAYSAQEVAHLFSQTVLHPFDVQIKKLISKSALEAAVIVAVSPLAVIDMFFLSWRNIRL VNQIAQIYGIELGYWSRLRLLKMVLLNLAFAGATEVVQDIGLDWLSQDLTAKLSARAAQG IGVGLLTARLGIKAMEFCRPLAFQAGEKPRLNHIQQELLGQLRSTFFRSNKTKVKQQV
Uniprot No.

Target Background

Database Links

KEGG: pmu:PM0909

STRING: 272843.PM0909

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Pasteurella multocida UPF0283 membrane protein PM0909?

The UPF0283 membrane protein PM0909 (UniProt ID: Q9CMC3) is a membrane-associated protein from Pasteurella multocida (strain Pm70). The protein consists of 358 amino acids with multiple transmembrane domains and a molecular weight of approximately 40 kDa. The amino acid sequence indicates several hydrophobic regions consistent with its classification as a membrane protein .

The protein contains characteristic structural elements:

  • Multiple transmembrane helical domains

  • Conserved regions typical of bacterial membrane transport proteins

  • A distinctive hydrophobic core

While the precise function remains under investigation, structural analysis suggests potential roles in membrane transport, signaling, or maintaining membrane integrity, similar to other bacterial membrane proteins with comparable topologies.

How does PM0909 compare structurally with other membrane proteins in bacterial pathogens?

Comparative structural analysis shows that PM0909 shares several characteristics with other bacterial membrane proteins, particularly those involved in transport mechanisms. Using techniques similar to those applied to mitochondrial carrier family (MCF) proteins, researchers can assess structural homology through:

  • Root mean square deviation (RMSD) analysis

  • Template modeling scores (TM-scores)

  • Multiple sequence alignment (MSA) of conserved regions

For meaningful structural comparisons, consider analyzing conserved glycine, proline, charged, and aromatic residues throughout the protein sequence, as these are often critical for maintaining functional conformations in membrane proteins . Structural predictions suggest PM0909 contains alpha-helical domains similar to those found in other bacterial transporters, though with distinct arrangements that may reflect its specialized function in P. multocida.

What are the recommended expression systems for recombinant PM0909 protein?

For effective expression of the recombinant PM0909 membrane protein, an E. coli-based expression system using a pET vector (such as pET26b+) is recommended. This approach has proven successful for similar membrane proteins, particularly when optimized with the following elements:

  • Signal sequence incorporation: Include a pelB leader sequence to target the protein to the bacterial inner membrane, facilitating proper folding

  • Affinity tag addition: A C-terminal 6xHis-tag enables efficient purification while minimizing interference with protein folding

  • Strain selection: Utilize specialized E. coli strains such as BL21(DE3), BL21 C43(DE3), or BL21 Lobstr(DE3), which are engineered for membrane protein expression

  • Induction method: Implement a modified autoinduction protocol rather than IPTG induction, allowing for gentler expression conditions that improve membrane protein yield and quality

This strategy results in significantly higher yields of properly folded recombinant protein compared to conventional cytoplasmic expression methods.

What purification protocol ensures optimal yield while maintaining native conformation of PM0909?

A multi-step purification protocol that preserves the native-like conformation of PM0909 should include:

  • Membrane fraction isolation:

    • Cell lysis via sonication or French press

    • Differential centrifugation to isolate membrane fractions

    • Washing steps to remove peripheral proteins

  • Detergent extraction optimization:

    • Use mild non-denaturing detergents like octyl glucoside (OG)

    • Optimize detergent:protein ratios (typically 10:1 to 20:1)

    • Include stabilizing agents (glycerol 10-15%)

  • Immobilized metal affinity chromatography (IMAC):

    • Nickel or cobalt resin with gradient elution

    • Buffer optimization with detergent concentrations above CMC

  • Quality assessment:

    • Semi-native SDS-PAGE to verify monomeric state

    • Western blotting with specific antibodies

    • Mass spectrometry to confirm protein identity and pelB cleavage

This approach typically yields 2-5 mg of purified protein per liter of bacterial culture, with >90% purity as assessed by SDS-PAGE.

Purification StepBuffer CompositionImportant ParametersExpected Yield
Membrane isolation50 mM Tris-HCl pH 7.5, 200 mM NaClCentrifugation: 100,000g, 1hTotal membrane fraction
Detergent extractionAbove + 1-2% Octyl glucoside4°C overnight extraction70-80% of membrane protein
IMAC purificationAbove + 0.5% detergent, 20-250 mM imidazole gradientFlow rate: 0.5 ml/min2-5 mg/L culture
Size exclusion20 mM HEPES pH 7.4, 100 mM NaCl, 0.1% detergentSuperdex 200 column>90% pure protein

How can researchers assess the functionality of recombinant PM0909 after purification?

To evaluate the functional integrity of purified recombinant PM0909, implement a multi-faceted approach:

  • Secondary structure verification:

    • Circular dichroism (CD) spectroscopy to confirm alpha-helical content characteristic of membrane proteins

    • Thermal stability assays to assess protein folding quality

  • Membrane incorporation studies:

    • Reconstitution into liposomes composed of bacterial membrane lipids

    • Verification of insertion using density gradient centrifugation

    • Assessment of oligomeric state (monomeric vs. multimeric forms) via semi-native electrophoresis

  • Binding assays:

    • Surface plasmon resonance (SPR) with potential ligands

    • Isothermal titration calorimetry (ITC) to determine binding constants

  • Structural integrity confirmation:

    • Limited proteolysis to assess proper folding

    • Mass spectrometry analysis to verify post-translational modifications and proper processing

What are common challenges in obtaining stable, properly folded PM0909, and how can they be addressed?

Researchers frequently encounter several challenges when working with PM0909:

  • Inclusion body formation:

    • Challenge: Overexpression often leads to inclusion body formation

    • Solution: Lower expression temperature (16-20°C), use autoinduction medium instead of IPTG, and incorporate molecular chaperones (GroEL/ES) in the expression system

  • Protein aggregation during purification:

    • Challenge: Tendency to aggregate after detergent extraction

    • Solution: Screen multiple detergents (DDM, LMNG, OG) at different concentrations, add stabilizing agents like glycerol (10-15%) and specific lipids (E. coli polar lipids extract)

  • Loss of structural integrity:

    • Challenge: Denaturation during purification steps

    • Solution: Maintain detergent above critical micelle concentration throughout all steps, include reducing agents to prevent disulfide bond formation

  • Low expression yield:

    • Challenge: Poor expression in conventional systems

    • Solution: Use specialized strains like C43(DE3) specifically engineered for toxic membrane proteins, optimize codon usage for E. coli expression

Each challenge requires systematic optimization, with documentation of conditions that successfully maintain protein stability and activity.

How can researchers distinguish between monomeric and oligomeric forms of PM0909, and what is the functional significance?

Distinguishing between monomeric and oligomeric forms of PM0909 requires complementary analytical approaches:

  • Electrophoretic techniques:

    • Semi-native SDS-PAGE with varying concentrations of SDS (0.1%-1%)

    • Blue-native PAGE to preserve native protein interactions

    • Crosslinking followed by SDS-PAGE to capture transient interactions

  • Biophysical methods:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation to determine sedimentation coefficients

    • Native mass spectrometry to determine precise oligomeric state

  • Microscopy approaches:

    • Single-particle cryo-electron microscopy

    • Atomic force microscopy of reconstituted proteins

Functionally, oligomeric states often correspond to different activities, as observed with other membrane proteins:

  • Monomers may represent inactive or transport-incompetent forms

  • Dimers or tetramers could represent the functional unit for transport or signaling

  • Higher-order oligomers might indicate regulatory complexes

Similar to UCP4, which forms stable tetramers in lipid membranes , PM0909 may undergo functional oligomerization. When reconstituted into liposomes, monitor the distribution between monomeric and oligomeric forms using the analytical methods described above.

How can PM0909 be utilized in studying P. multocida infections and developing therapeutic strategies?

PM0909 offers several valuable research applications for understanding P. multocida pathogenesis:

  • Vaccine development:

    • As a membrane protein, PM0909 represents a potential vaccine target

    • Recombinant PM0909 can be used to raise antibodies for passive immunization studies

    • Epitope mapping can identify immunogenic regions for subunit vaccine design

  • Diagnostic development:

    • Purified PM0909 can serve as a standard antigen in ELISA-based diagnostic tests

    • Anti-PM0909 antibodies may enable rapid identification of P. multocida in clinical samples

    • Quantification of anti-PM0909 antibodies could indicate exposure status in epidemiological studies

  • Therapeutic target validation:

    • If PM0909 plays a role in virulence, it may represent a novel therapeutic target

    • High-throughput screening using purified PM0909 can identify potential inhibitors

    • Structure-based drug design approaches become feasible with purified protein

  • Host-pathogen interaction studies:

    • Labeled PM0909 can be used to identify host cell receptors or binding partners

    • Mutagenesis studies can map functional domains involved in pathogenesis

These applications are particularly relevant given that P. multocida infections are associated with various clinical manifestations and disproportionately affect certain populations like infants and the elderly .

What advanced structural analysis techniques are most appropriate for PM0909, and what insights might they provide?

For comprehensive structural characterization of PM0909, researchers should consider these advanced techniques:

  • X-ray crystallography challenges and solutions:

    • Challenge: Membrane proteins are notoriously difficult to crystallize

    • Solutions: Lipidic cubic phase crystallization, antibody fragment co-crystallization to stabilize flexible regions, and surface engineering to promote crystal contacts

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for oligomeric assemblies

    • Benefits from recent advances in detector technology and processing algorithms

    • May reveal dynamic conformational states relevant to function

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution NMR for flexible regions and ligand binding studies

    • Solid-state NMR for membrane-embedded regions

    • Can provide dynamics information not accessible by static methods

  • Molecular dynamics simulations:

    • Atomistic simulations of PM0909 in membrane environments

    • Investigation of conformational changes associated with transport or signaling

    • Integration with experimental data for validated models

Structural insights would elucidate:

  • Transport mechanism if PM0909 functions as a transporter

  • Potential binding sites for small molecules or host factors

  • Structural basis for oligomerization

  • Conformational changes associated with function

These insights would significantly advance understanding of PM0909's role in P. multocida biology and potentially identify structural features that could be targeted therapeutically.

How does PM0909 compare with other bacterial membrane proteins in terms of purification challenges and solutions?

Comparative analysis reveals both shared challenges and unique considerations for PM0909 purification:

Protein FamilyCommon ChallengesSuccessful Strategies for PM0909Unique Considerations
Bacterial transportersDetergent extraction efficiencyOptimized octyl glucoside extractionPM0909 requires higher salt concentration (200-300 mM)
Channel proteinsMaintaining oligomeric stateSemi-native purification conditionsMonitor monomer-oligomer equilibrium during all steps
Signaling proteinsLigand stabilizationAddition of potential binding partnersUnknown ligands require empirical stabilization testing
Mitochondrial carriersReconstitution efficiencyBacterial lipid mimics for reconstitutionDifferent lipid preferences than mitochondrial proteins

While techniques similar to those used for mitochondrial carrier proteins provide a starting point, PM0909 purification benefits from:

  • Modified detergent extraction protocols

  • Specialized membrane targeting via pelB leader sequence

  • Customized reconstitution conditions reflecting bacterial membrane composition

These adaptations address the specific biochemical properties of PM0909 while building on established membrane protein methodologies.

What can researchers learn from studying PM0909 in the context of P. multocida antibiotic resistance?

Studying PM0909 in relation to antibiotic resistance offers several research opportunities:

  • Correlation with resistance phenotypes:
    P. multocida exhibits varying patterns of antibiotic resistance, with documented resistance to penicillins, β-lactams, macrolides, lincosamides, and glycopeptides . Researchers should investigate:

    • PM0909 expression levels in resistant versus susceptible clinical isolates

    • Potential structural modifications in PM0909 from resistant strains

    • Correlation between PM0909 variants and minimum inhibitory concentrations (MICs)

  • Membrane protein contribution to resistance mechanisms:
    Membrane proteins like PM0909 may contribute to resistance through:

    • Alteration of membrane permeability to antibiotics

    • Participation in efflux pump complexes

    • Modification of bacterial surface properties affecting antibiotic binding

  • PM0909 as a resistance marker:
    Research should explore whether PM0909 expression or modification correlates with:

    • Resistance to specific antibiotic classes

    • Multiple drug resistance phenotypes

    • Strain-specific resistance patterns observed in different clinical specimens (blood, respiratory tract, wounds)

This research direction is particularly important given that P. multocida strains from different clinical origins (blood, wounds, respiratory tract) show significantly different antibiotic resistance profiles (p = 0.0033) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.