Recombinant Pasteurella multocida UPF0761 membrane protein PM1616 (PM1616)

Shipped with Ice Packs
In Stock

Description

Biological Context in Pasteurella multocida

PM1616 is annotated as a UPF0761 family membrane protein, though its specific role in bacterial physiology or virulence is not fully elucidated. Notably:

  • Capsule Deficiency: Strains such as Pm1616 lack a functional capsule locus, a critical virulence factor in P. multocida. Capsule quantification assays confirmed the acapsular nature of Pm1616, which may influence host immune evasion and pathogenicity .

  • Genetic Environment: In acapsular strains like Pm1616, the genes grxD (glutaredoxin) and DUF441 flank the absent capsule locus, suggesting potential regulatory or compensatory roles for adjacent genomic regions .

3.1. Antigenicity and Vaccine Development

While PM1616 itself has not been directly tested as a vaccine candidate, studies on other P. multocida outer membrane proteins (e.g., OmpH, PlpE) highlight the potential of recombinant membrane proteins to elicit protective immune responses . For example:

  • Multi-protein formulations (e.g., rOmpH + rPlpE + rVacJ) achieved 100% protection in ducks against lethal challenges .

  • PM1616’s surface exposure and conservation across strains could make it a candidate for similar subunit vaccine strategies, though experimental validation is lacking .

3.2. Functional and Pathway Analysis

Current databases list no confirmed pathways or interacting partners for PM1616, underscoring the need for further studies to clarify its role in bacterial metabolism or host interactions .

Comparative Analysis of Acapsular Strains

Strain Pm1616’s acapsular phenotype contrasts with encapsulated P. multocida isolates, which typically cause severe systemic infections. Key observations include:

FeatureCapsulated StrainsAcapsular Strains (e.g., Pm1616)
Capsule ProductionPresent (e.g., serogroups A, B)Absent (confirmed via biochemical assays)
VirulenceHigh (systemic spread)Attenuated (reduced colonization)
Immune EvasionEnhancedCompromised

The absence of a capsule in Pm1616 may render it more susceptible to host immune clearance, providing a model to study capsule-independent virulence mechanisms .

Future Research Directions

  • Structural Studies: Cryo-EM or X-ray crystallography could resolve PM1616’s 3D structure to identify functional domains.

  • Knockout Models: Deleting pm1616 in wild-type strains may clarify its contribution to bacterial survival or virulence.

  • Immunogenicity Trials: Testing recombinant PM1616 in animal models could evaluate its potential as a diagnostic antigen or vaccine component.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PM1616; UPF0761 membrane protein PM1616
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Pasteurella multocida (strain Pm70)
Target Names
PM1616
Target Protein Sequence
MNNVLKNAGLFLRLFWLRFQQNKLSQAAGYLTYSTMLALVPLVMVVFSVFSAFPVFNEVT DELKGFIFNNFAPQASDMVGQYIDEFVSNSKQMSAVGVISLVVVALMLINSIDRTLNSIW HDTTIRPLVFSFAIYWLILTLGPLLIGASIGVSSYIAAMLNENISLPFGLKILSFVPFFL TWLIFTLIYTVVPNKKVKIMHSAIGALVAAVFFTLGKQAFLWYVTTFPSYQLIYGAMATL PIMLLWIQLSWVVILIGAQLASVLADYTLCTQGKIRVEELVAADTHEPALQQKMEKTEQT LKTEITQQKQRLEKQG
Uniprot No.

Target Background

Database Links

KEGG: pmu:PM1616

STRING: 272843.PM1616

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pasteurella multocida and what role does the PM1616 protein play in its biology?

Pasteurella multocida is a Gram-negative, nonmotile, penicillin-sensitive coccobacillus classified into five serogroups (A, B, D, E, F) based on capsular composition and 16 somatic serovars (1-16). This bacterium causes various diseases including fowl cholera in poultry, atrophic rhinitis in pigs, and bovine hemorrhagic septicemia in cattle and buffalo . It can also cause zoonotic infections in humans, typically resulting from bites or scratches from domestic pets .

The PM1616 protein is classified as a UPF0761 membrane protein found in P. multocida strain Pm70. While its specific function remains under investigation, as a membrane protein, it likely contributes to cellular integrity, transport processes, or host-pathogen interactions. The protein has been identified in both capsulated and acapsular strains, suggesting a conserved role independent of capsule production.

Methodologically, researchers investigating this protein should consider:

  • Comparative genomics across multiple P. multocida strains

  • Gene knockout studies to assess phenotypic changes

  • Protein localization studies using immunofluorescence

  • Structure prediction using bioinformatics approaches

How can recombinant PM1616 protein be expressed and purified for laboratory studies?

Expression and purification of recombinant PM1616 protein can be achieved through several host systems, including E. coli, yeast, baculovirus, or mammalian cells . For academic research purposes, E. coli expression systems are most commonly used due to their cost-effectiveness and high yield.

A standard methodological approach involves:

  • Gene synthesis or PCR amplification of the PM1616 coding sequence

  • Cloning into a suitable expression vector (such as pET-series)

  • Transformation into an expression strain (commonly BL21(DE3))

  • Optimization of expression conditions (temperature, induction time, IPTG concentration)

  • Cell lysis using appropriate methods (sonication, French press)

  • Affinity chromatography using tags (His-tag is commonly employed)

  • Further purification using ion exchange or size exclusion chromatography

  • Quality assessment via SDS-PAGE and Western blotting

For membrane proteins like PM1616, additional considerations include:

  • Using specialized E. coli strains designed for membrane protein expression

  • Including detergents during extraction and purification

  • Optimizing buffer compositions to maintain protein stability

  • Considering fusion partners that enhance solubility

What are the characteristics of acapsular Pasteurella multocida strains that express PM1616?

Several P. multocida strains, including Pm1616, Pm1617, and Pm1621 isolated from cats, and Past6, Past33, P1591, and NCTC 11620 isolated from human infections, lack a capsule locus . These acapsular strains show distinctive genomic organization where the genes typically flanking the capsule locus (grxD and DUF441) are immediately adjacent to each other on a single contig .

Experimentally, capsule quantification assays confirm these strains produce no measurable capsule when compared to known capsulated strains like P. multocida VP161 . The absence of capsule may affect various aspects of bacterial physiology and pathogenicity.

For researchers studying these strains, important methodological considerations include:

  • Genomic verification of capsule locus absence

  • Phenotypic confirmation through capsule staining techniques

  • Comparative virulence studies between capsulated and acapsular strains

  • Analysis of membrane protein expression profiles and their accessibility

How does membrane localization of PM1616 differ between capsulated and acapsular Pasteurella multocida strains?

The membrane architecture differences between capsulated and acapsular P. multocida strains present an important research question regarding PM1616 localization and accessibility. In acapsular strains like Pm1616, the absence of the polysaccharide capsule may alter the exposure and organization of membrane proteins.

Methodological approaches to investigate this question include:

  • Membrane fractionation to isolate outer membrane proteins

  • Proteomic analysis comparing membrane protein profiles between strain types

  • Accessibility studies using surface biotinylation techniques

  • Immunogold electron microscopy to visualize protein distribution

  • Functional accessibility assays using antibodies or ligands

Strain TypeCapsule StatusExpected PM1616 AccessibilityExperimental Approach
Pm1616AcapsularPotentially higherSurface biotinylation, immunogold EM
Capsulated strainsEncapsulatedPotentially lowerMembrane fractionation, proteomics
isogenic mutantsVariableComparativeCross-comparison analysis

The insights gained from such studies would contribute to understanding how capsule expression influences membrane protein organization and potential implications for pathogenesis and vaccine development.

What is the immunogenic potential of PM1616 compared to established Pasteurella multocida vaccine antigens?

While specific immunogenicity data for PM1616 is not detailed in the search results, methodological approaches can be extrapolated from studies on other P. multocida proteins. Research on recombinant VacJ, PlpE, and OmpH proteins has demonstrated significant immunogenic potential, with antibody responses in vaccinated ducks being significantly antigenic (p<0.005) .

A comprehensive immunological evaluation of PM1616 would include:

  • Recombinant protein production with preserved conformational epitopes

  • In silico epitope prediction and analysis

  • Animal immunization studies with appropriate adjuvants

  • Antibody titer measurements via ELISA

  • Challenge studies to assess protective efficacy

  • Comparative analysis with established antigens

Based on studies with similar proteins, a potential immunization protocol would be:

Immunization StepTimingFormulationRoute
Primary doseDay 0rPM1616 with water-in-oil adjuvantIntramuscular
Booster doseDay 21rPM1616 with same adjuvantIntramuscular
ChallengeDay 35Virulent P. multocida (20 LD50)Intraperitoneal

Researchers should note that combinations of recombinant proteins can provide enhanced protection compared to single antigens. For example, a formulation containing rVacJ, rPlpE, and rOmpH provided 100% protection against challenge, while individual proteins ranged from 33.3% to 83.33% protection .

How can structural characterization of PM1616 contribute to understanding its function in Pasteurella multocida?

Structural characterization of PM1616 presents significant challenges but offers valuable insights into its biological function. As a membrane protein, conventional structural determination methods like X-ray crystallography may be challenging.

A comprehensive structural investigation would employ:

Researchers should establish structure-function relationships through:

  • Site-directed mutagenesis of predicted functional residues

  • Functional assays before and after specific modifications

  • Ligand binding studies to identify interaction partners

  • Cross-linking experiments to capture transient interactions

What are optimal expression systems for producing functional recombinant PM1616 protein?

Producing functional recombinant membrane proteins like PM1616 requires careful optimization of expression systems. While E. coli remains the most accessible system, alternative hosts might offer advantages for specific applications.

A systematic approach to expression optimization includes:

  • Vector selection:

    • pET series vectors with T7 promoter for high-level expression

    • pBAD vectors for tightly controlled arabinose-inducible expression

    • Vectors with fusion partners (MBP, SUMO, Trx) to enhance solubility

  • Host strain selection:

    • BL21(DE3) derivatives for general expression

    • C41(DE3)/C43(DE3) for toxic membrane proteins

    • Lemo21(DE3) for tunable expression levels

  • Expression condition optimization:

    • Temperature range (16-37°C)

    • Induction concentration (0.01-1.0 mM IPTG)

    • Growth media (LB, TB, autoinduction)

    • Expression duration (3h to overnight)

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, easy handlingLimited PTMs, inclusion bodiesInitial characterization
YeastEukaryotic PTMs, high densityLonger culture timeFunctional studies
BaculovirusComplex PTMs, proper foldingTechnical complexityStructural studies
MammalianNative-like PTMsLow yield, expensiveInteraction studies

Success should be evaluated using multiple criteria including yield, purity, homogeneity, and functional activity before proceeding to downstream applications.

How can researchers design challenge studies to evaluate the protective efficacy of PM1616-based vaccines?

Designing robust challenge studies to evaluate PM1616 as a vaccine candidate requires careful methodology based on established protocols for other P. multocida antigens.

A comprehensive challenge study design includes:

  • Animal model selection:

    • Natural host species (ducks for fowl cholera studies)

    • Age-matched, pathogen-free animals

    • Appropriate sample size with statistical power calculations

    • Control groups (unvaccinated, adjuvant-only, positive control)

  • Vaccination protocol:

    • Dose optimization through preliminary studies

    • Prime-boost schedule (typically 21 days apart)

    • Route of administration (subcutaneous, intramuscular)

    • Adjuvant selection based on immune response type needed

  • Challenge parameters:

    • Virulent strain selection (serotype matching field isolates)

    • Standardized challenge dose (typically 20 LD50)

    • Route mimicking natural infection

    • Monitoring period determination

  • Evaluation criteria:

    • Survival rate

    • Clinical score systems

    • Bacterial load in tissues

    • Histopathological evaluation

    • Immunological correlates of protection

Assessment ParameterMethodologyTimingExpected Outcome
Antibody titersELISAPre-challengeCorrelation with protection
Clinical signsScoring systemDaily post-challengeReduced severity in vaccinated
Bacterial loadTissue cultureTerminalReduced colonization
HistopathologyTissue sectionsTerminalReduced pathology
Cytokine profileMultiplex assayVarious timepointsTh1/Th2 balance

Based on similar studies with other P. multocida proteins, researchers should expect varying protection levels ranging from 33.3% to 100% depending on the antigen combination used .

What techniques can effectively demonstrate the membrane localization of PM1616 in its native bacterial context?

Confirming the membrane localization of PM1616 in native P. multocida requires specialized techniques that maintain cellular integrity while providing specific detection.

A comprehensive localization study would employ:

  • Subcellular fractionation:

    • Differential centrifugation to separate cellular components

    • Extraction with mild detergents for membrane proteins

    • Western blotting of fractions with anti-PM1616 antibodies

    • Verification with known compartment markers

  • Microscopy approaches:

    • Immunofluorescence with anti-PM1616 antibodies

    • Immunogold electron microscopy for precise localization

    • Super-resolution microscopy for detailed distribution

    • Co-localization with known membrane markers

  • Topology mapping:

    • Protease accessibility assays in whole cells vs. spheroplasts

    • Reporter fusion constructs (PhoA/LacZ) at different positions

    • Selective labeling of surface-exposed regions

    • Cysteine scanning mutagenesis with membrane-impermeable reagents

  • Functional confirmation:

    • Accessibility to antibodies in live cells

    • Immunoprecipitation from intact cells

    • Surface biotinylation assays

    • Liposome reconstitution studies

The combination of these approaches provides complementary evidence for membrane localization and orientation of the protein within the membrane.

How should researchers analyze comparative genomics data to understand PM1616 conservation across Pasteurella species?

Comparative genomic analysis of PM1616 across Pasteurella species and strains provides insights into evolutionary conservation and functional importance. A methodical approach to such analysis includes:

  • Sequence acquisition and alignment:

    • Collect PM1616 homologs via BLAST searches against genomic databases

    • Perform multiple sequence alignment using MUSCLE or MAFFT

    • Calculate sequence identity and similarity metrics

    • Identify conserved domains and variable regions

  • Phylogenetic analysis:

    • Select appropriate evolutionary models

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Assess tree reliability through bootstrap or posterior probability

    • Correlate evolutionary patterns with host specificity or virulence

  • Structural variation analysis:

    • Identify insertions, deletions, and rearrangements

    • Map variations to predicted functional domains

    • Calculate selection pressure (dN/dS ratios) across the sequence

    • Identify sites under positive or purifying selection

  • Genomic context examination:

    • Analyze genomic neighborhood conservation

    • Identify co-evolving genes

    • Assess horizontal gene transfer evidence

    • Compare against capsule locus organization

Analysis LevelToolsMetricsInterpretation
SequenceBLAST, MUSCLE% identity, similarityEvolutionary distance
PhylogenyRAxML, MrBayesBootstrap valuesEvolutionary relationships
SelectionPAML, HyPhydN/dS ratioFunctional constraints
StructureI-TASSER, SWISS-MODELConservation mappingFunctional domains

The analysis should distinguish between core (highly conserved) and accessory (variable) regions of the protein, which may correlate with essential functions versus host-adaptation roles.

What statistical approaches are appropriate for evaluating PM1616 vaccine efficacy data?

Proper statistical analysis is crucial for interpreting vaccine efficacy data. Based on established methodology for similar P. multocida proteins, appropriate statistical approaches include:

  • Survival analysis:

    • Kaplan-Meier survival curves with log-rank test

    • Cox proportional hazards modeling for covariate analysis

    • Calculation of relative risk reduction

    • Determination of number needed to vaccinate (NNV)

  • Antibody response analysis:

    • ANOVA or Kruskal-Wallis for multi-group comparisons

    • Post-hoc tests with appropriate corrections for multiple comparisons

    • Correlation analysis between antibody titers and protection

    • Regression models to identify protective thresholds

  • Bacterial load assessment:

    • Log transformation of CFU data for normality

    • Mixed-effects models for repeated measures

    • Non-parametric tests for non-normal distributions

    • Area under the curve analysis for clearance kinetics

  • Study design considerations:

    • A priori sample size calculations

    • Randomization procedures

    • Blinding methodology

    • Controlling for environmental factors

Outcome MeasureStatistical TestPower ConsiderationsPresentation Format
Survival rateLog-rank testSample size based on expected effectKaplan-Meier curves
Antibody titersANOVA/t-testEffect size from pilot studiesBox plots, scatter plots
Bacterial loadMann-Whitney UNon-parametric powerLog-scale box plots
Tissue pathologyChi-squareCategorical outcome powerContingency tables

Researchers should report both statistical significance (p-values) and effect sizes with confidence intervals to provide complete interpretation of results.

How can researchers interpret contradictory findings between in vitro and in vivo studies of PM1616?

Resolving contradictions between in vitro and in vivo findings is a common challenge in protein characterization studies. A systematic approach to interpreting such discrepancies includes:

  • Methodological comparison:

    • Identify differences in protein preparation methods

    • Compare experimental conditions (pH, temperature, ionic strength)

    • Assess the relevance of in vitro conditions to in vivo environment

    • Evaluate the sensitivity and specificity of detection methods

  • Contextual considerations:

    • In vitro systems lack the complex host environment

    • Protein may require in vivo factors for proper folding/function

    • Host factors may modify protein activity

    • Temporal aspects of expression and regulation

  • Resolution strategies:

    • Develop more physiologically relevant in vitro systems

    • Use ex vivo approaches as intermediary models

    • Employ tissue-specific or cell-specific in vivo analyses

    • Design experiments to specifically test hypothesized reasons for discrepancies

  • Integration framework:

    • Develop models that incorporate both datasets

    • Weight evidence based on methodological strength

    • Design confirmatory experiments targeting specific discrepancies

    • Consider systems biology approaches for complex interactions

A structured evaluation table can help systematize the analysis:

FindingIn Vitro EvidenceIn Vivo EvidencePotential ExplanationsResolution Approach
Example: ImmunogenicityHigh antibody bindingPoor protectionConformational differences, Wrong epitopesEpitope mapping, Structural studies
Example: LocalizationMembrane fractionCytoplasmic stainingExtraction artifacts, Antibody specificityMultiple detection methods
Example: FunctionTransport activityNo phenotype in knockoutRedundancy in vivo, Artificial substratesDouble knockouts, Native substrate

What genomic and proteomic approaches could elucidate the functional role of PM1616 in Pasteurella multocida virulence?

Understanding the role of PM1616 in P. multocida virulence requires integrated genomic and proteomic approaches:

  • Genomic strategies:

    • Gene knockout or CRISPR-Cas9 genome editing

    • Complementation studies to confirm phenotypes

    • Transcriptomic analysis under infection-relevant conditions

    • Comparative genomics between virulent and avirulent strains

    • Transposon mutagenesis for high-throughput screening

  • Proteomic approaches:

    • Pull-down assays to identify interaction partners

    • Quantitative proteomics comparing wild-type and mutant strains

    • Phosphoproteomics to identify regulatory events

    • Membrane proteomics under host-mimicking conditions

    • Protein turnover studies during infection

  • Functional assessments:

    • Adhesion and invasion assays with host cells

    • Biofilm formation capacity

    • Serum resistance testing

    • Intracellular survival in phagocytes

    • Animal infection models with tissue-specific analyses

  • Multi-omics integration:

    • Correlation of transcriptomic and proteomic profiles

    • Network analysis to place PM1616 in biological pathways

    • System-level modeling of virulence mechanisms

    • Machine learning approaches to identify patterns

Each approach provides complementary insights, and the integration of multiple datasets offers the most comprehensive understanding of PM1616's role in virulence.

How might structural biology advances contribute to rational design of PM1616-based vaccine epitopes?

Advanced structural biology techniques can accelerate rational vaccine design based on PM1616:

  • Structure determination approaches:

    • Cryo-electron microscopy for membrane proteins

    • NMR spectroscopy for dynamic regions

    • X-ray crystallography for soluble domains

    • Integrative structural biology combining multiple techniques

    • AlphaFold or RoseTTAFold for computational prediction

  • Epitope identification strategies:

    • Computational B-cell epitope prediction

    • Hydrogen-deuterium exchange mass spectrometry

    • Phage display with antibody fragments

    • Peptide array screening with immune sera

    • Structural mapping of conserved surface regions

  • Rational design approaches:

    • Structure-based epitope optimization

    • Presentation on nanoparticle platforms

    • Multiepitope constructs with optimized linkers

    • Conformational stabilization of key epitopes

    • Glycoengineering for enhanced immunogenicity

  • Validation methods:

    • Binding studies with monoclonal antibodies

    • Neutralization assays

    • Structural confirmation of epitope conformation

    • Animal immunization with epitope-focused constructs

    • T-cell epitope mapping for complete immune response

Design ApproachStructural InputOutputValidation Method
Surface mapping3D structureExposed epitopesAntibody accessibility
Discontinuous epitopesDomain interactionsConformational epitopesConformation-specific antibodies
Stabilized scaffoldsFlexible regionsLocked conformationsThermal stability assays
Interface targetingProtein-protein contactsNeutralizing epitopesFunctional inhibition

This structural biology pipeline can transform PM1616 from a poorly characterized protein into a rationally designed vaccine component with optimized immunogenicity and protection.

What comparative immunology studies would best determine the cross-species protection potential of PM1616-based vaccines?

Pasteurella multocida affects multiple host species, making cross-species protection an important consideration for PM1616-based vaccines:

  • Host range assessment:

    • Sequence analysis of PM1616 across strains from different hosts

    • Antigenic epitope conservation prediction

    • In vitro binding studies with sera from different species

    • Cross-reactivity assessment with isolates from diverse sources

  • Multi-species immunization studies:

    • Parallel immunization trials in relevant host species

    • Standardized antigen preparation and adjuvant formulation

    • Comparative antibody response measurement

    • Cross-species challenge with heterologous strains

  • Immune response characterization:

    • Epitope recognition patterns across species

    • Antibody isotype distribution comparison

    • T-cell response profiling

    • Cytokine signatures and correlation with protection

  • Practical application considerations:

    • Dose optimization for different species

    • Adjuvant requirements across species

    • Age-dependent response patterns

    • Duration of immunity comparison

Host SpeciesRelevant P. multocida SerotypesDisease ManifestationImmune Response Focus
PoultryA:1, A:3Fowl choleraHumoral immunity
CattleB:2, E:2Hemorrhagic septicemiaAntibody + cell-mediated
SwineD:1, A:3Atrophic rhinitisMucosal immunity
Companion animalsA:1, F:1Respiratory diseaseMixed response

The results would guide the development of either host-specific vaccines or broader cross-protective formulations depending on the conservation of protective epitopes across P. multocida strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.