Recombinant Pectobacterium carotovorum subsp. carotovorum 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

4-Hydroxybenzoate octaprenyltransferase (ubiA) is an intramembrane prenyltransferase belonging to the UbiA superfamily, which is conserved across prokaryotes and eukaryotes . In Pectobacterium carotovorum, this enzyme facilitates the first committed step of ubiquinone biosynthesis by attaching a hydrophobic octaprenyl side chain to 4-hydroxybenzoate (4-HB), forming 3-octaprenyl-4-hydroxybenzoate . This reaction is Mg²⁺-dependent and occurs in the bacterial inner membrane .

Sequence and Domains

  • Amino Acid Sequence: The recombinant protein spans residues 1–287 (UniProt ID: C6DKC9), with a molecular weight of ~32 kDa .

  • Catalytic Motifs: Contains conserved regions for substrate binding and catalysis, including residues critical for coordinating Mg²⁺ ions .

Catalytic Mechanism

The enzyme binds 4-HB and farnesylfarnesylgeraniol (a precursor of octaprenyl pyrophosphate) to form 3-octaprenyl-4-hydroxybenzoate, releasing pyrophosphate . Key characteristics include:

  • Mg²⁺ Dependency: Optimal activity requires Mg²⁺ (5–10 mM) .

  • Membrane Localization: Both the enzyme and its lipid substrate are membrane-bound .

  • Kinetic Parameters: In E. coli homologs, KmK_m for 4-HB is ~10 μM .

Mutational Studies

  • ubiA ⁻ mutants in E. coli lack enzyme activity and accumulate unmetabolized 4-HB, confirming its role in ubiquinone synthesis .

  • Mutations in conserved residues (e.g., Asp/Glu for Mg²⁺ coordination) abolish activity .

Expression Systems

  • Host: Typically expressed in E. coli or yeast systems for high yield .

  • Purification: Affinity chromatography (e.g., His-tag) followed by size-exclusion chromatography achieves >90% purity .

Research Applications

  1. Ubiquinone Biosynthesis Studies: Used to elucidate mechanisms of respiratory chain assembly in plant-pathogenic bacteria .

  2. Antimicrobial Target: Inhibitors of UbiA could disrupt ubiquinone synthesis, offering potential antibiotics .

  3. Comparative Enzymology: Structural comparisons with homologs (e.g., Haemophilus somnus UbiA) reveal evolutionary adaptations .

Key Research Findings

  • Membrane Integration: The enzyme’s N-terminal domain anchors it to the membrane, while the C-terminal domain binds substrates .

  • Substrate Flexibility: Unlike E. coli UbiA, the Pectobacterium enzyme shows broader specificity for polyprenyl diphosphates .

  • Disease Relevance: Homologs like human COQ2 are linked to mitochondrial disorders, highlighting conserved mechanistic features .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; PC1_0511; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
ubiA
Target Protein Sequence
MERSVTAGKWLAYCRLMRIDKPIGSLLLLWPTLWALWLAGGGAPAPWTLFVFVAGVFLMR AAGCVINDYADRHFDGHVKRTASRPLPSGEVSEQSAKVLFVVLVLLAFGLVLTLNTMTIW LSVAGLGLAWVYPFMKRVSHLPQFVLGAAFGWSIPMAYAAVSESLPATCWMMFLAYICWT VAYDTQYAMVDRDDDLKIGVKSTAILFGRFDNLIIGLLQFSMLALLLILGTMTGLGMPYY ISLLVAGGMFIYQQILTAGRERDACFKAFHNNKYAGMAIFIGVLFGL
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It plays a crucial role in the final steps of ubiquinone-8 (UQ-8) biosynthesis, specifically mediating the condensation of the polyisoprenoid side chain with PHB, leading to the generation of the first membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ubiA and what is its primary function?

UbiA (4-hydroxybenzoate octaprenyltransferase) is an essential enzyme involved in the ubiquinone biosynthesis pathway. In Pectobacterium carotovorum, it catalyzes the prenylation of 4-hydroxybenzoate with an octaprenyl diphosphate to form 3-octaprenyl-4-hydroxybenzoate. This reaction represents a critical step in the biosynthesis of ubiquinone (coenzyme Q), which functions as an electron carrier in the respiratory chain. The enzyme belongs to the UbiA prenyltransferase family and exhibits polyprenyltransferase activity, enabling the attachment of prenyl side chains to aromatic substrates .

How does the structure of ubiA relate to its function?

The UbiA enzyme typically contains multiple transmembrane domains that anchor it to the inner membrane. Its active site includes conserved aspartate-rich motifs that coordinate divalent metal ions (typically Mg²⁺), which are essential for catalysis. These structural features create a hydrophobic binding pocket that properly positions both the aromatic substrate (4-hydroxybenzoate) and the prenyl donor (octaprenyl diphosphate) for the transferase reaction. The transmembrane positioning is critical because it allows the enzyme to operate at the interface where hydrophilic and hydrophobic substrates meet .

What are the common methods for studying ubiA expression?

Research on ubiA expression commonly employs reverse transcription polymerase chain reaction (RT-PCR) to evaluate transcriptional levels. For protein expression analysis, western blotting with antibodies specific to the UbiA protein or epitope tags is the standard approach. Researchers typically use specific primers designed based on the UbiA gene sequence with appropriate restriction sites (such as XhoI and Xbal) to facilitate cloning. The standard RT-PCR protocol involves initial denaturation at 94°C for 7 minutes, followed by 35 cycles of denaturation at 94°C for 1 minute, annealing at approximately 62°C for 45 seconds, and extension at 72°C for 1 minute, with a final extension at 72°C for 5 minutes .

What are the optimal conditions for cloning the ubiA gene from Pectobacterium carotovorum?

For optimal cloning of ubiA from Pectobacterium carotovorum, researchers should:

  • Isolate high-quality genomic DNA from fresh bacterial cultures using a specialized bacterial DNA extraction kit.

  • Design primers with appropriate restriction sites based on the ubiA sequence (GenBank data), typically incorporating sites compatible with your destination vector. Common successful designs include:

    • Forward primer with XhoI or EcoRI site

    • Reverse primer with XbaI or BamHI site

  • Optimize PCR conditions with a temperature gradient to determine the ideal annealing temperature (typically between 58-64°C).

  • Use a high-fidelity DNA polymerase to minimize mutations during amplification.

  • Perform colony PCR screening using gene-specific primers to identify positive transformants.

  • Confirm successful cloning through restriction enzyme digestion and DNA sequencing to ensure 99% identity with the reference sequence .

What expression vectors are most effective for recombinant ubiA production?

The effectiveness of expression vectors for recombinant ubiA production depends on the experimental goals:

  • For bacterial expression:

    • pET series vectors under T7 promoter control provide high-level expression in E. coli strains like BL21(DE3).

    • pGEX vectors yield GST-fusion proteins that facilitate purification.

  • For eukaryotic expression:

    • The pcDNA3 vector has proven effective for initial mammalian cell expression.

    • The PUAST vector system is particularly valuable for expressing ubiA in insect cells (such as S2 cells) and for generating transgenic Drosophila models, especially when combined with the GAL4-UAS system for tissue-specific expression .

  • For structural and functional studies:

    • Vectors containing C-terminal tags such as EGFP or polyhistidine allow for tracking expression and simplifying purification.

The choice depends on downstream applications, with PUAST vectors showing particular promise for recombinant UbiA production at around 60 kDa in eukaryotic systems .

How can I optimize the purification of recombinant ubiA protein?

Optimizing the purification of recombinant ubiA requires careful consideration of its membrane-bound nature:

  • Membrane protein extraction:

    • Use specialized detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) to solubilize the protein from membranes.

    • Employ ultracentrifugation (100,000 × g) to separate membrane fractions.

  • Affinity chromatography:

    • For His-tagged constructs, use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin.

    • For GST-fused constructs, employ glutathione sepharose.

    • Consider using cobalt-based resins for higher specificity with less background.

  • Buffer optimization:

    • Maintain 10-15% glycerol in all buffers to stabilize the protein.

    • Include 0.05-0.1% appropriate detergent to prevent aggregation.

    • Utilize protease inhibitors to minimize degradation.

  • Verification steps:

    • Confirm identity through western blot analysis as demonstrated in the literature, where a single band at approximately 60 kDa indicates purified UbiA protein .

    • Validate activity through enzymatic assays measuring the conversion of 4-hydroxybenzoate to prenylated products.

How does the catalytic mechanism of bacterial ubiA differ from human UbiA homologs?

The catalytic mechanism of bacterial ubiA and human UbiA homologs (such as COQ2) shares fundamental features but exhibits notable differences:

Both enzymes catalyze the prenylation of 4-hydroxybenzoate but differ in substrate specificity and regulatory mechanisms. The bacterial enzyme typically utilizes octaprenyl diphosphate as the prenyl donor, while human COQ2 preferentially uses decaprenyl or nonaprenyl diphosphate, reflecting differences in ubiquinone side chain length between species. Both enzymes require divalent metal ions for catalysis, typically Mg²⁺, which coordinates the diphosphate group of the prenyl donor.

Key differences include:

  • Substrate binding pocket architecture - bacterial ubiA accommodates shorter prenyl chains compared to human homologs.

  • Regulatory mechanisms - human UbiA prenyltransferase domain-containing proteins are implicated in multiple biosynthetic pathways, including menaquinone-4 synthesis, while bacterial ubiA is more specifically dedicated to ubiquinone biosynthesis .

  • Interactions with pathway partners - bacterial systems typically have simpler protein-protein interaction networks compared to the human complex that includes multiple COQ proteins in a biosynthetic complex.

These differences provide potential targets for developing antibacterial agents that specifically inhibit bacterial ubiA without affecting human homologs .

What methods are available for assessing ubiA enzymatic activity in vitro?

In vitro assessment of ubiA enzymatic activity can be conducted through several complementary approaches:

  • Radiometric assays:

    • Incubate purified ubiA with ¹⁴C-labeled 4-hydroxybenzoate and unlabeled octaprenyl diphosphate.

    • Extract products with organic solvents (e.g., hexane/ethyl acetate).

    • Quantify radioactive products via scintillation counting or autoradiography after TLC separation.

  • HPLC-based assays:

    • React purified enzyme with substrates under optimized conditions (pH 7.5-8.0, 2-5mM Mg²⁺).

    • Extract products and analyze by reverse-phase HPLC with UV detection at 254nm.

    • Identify products by comparison with authentic standards or by LC-MS analysis.

  • Coupled enzyme assays:

    • Design systems where pyrophosphate released during the reaction triggers a cascade producing a measurable output.

    • Monitor continuously using spectrophotometric methods.

  • Fluorescence-based methods:

    • Utilize fluorescent analogs of 4-hydroxybenzoate to track product formation.

    • Measure changes in fluorescence properties upon prenylation.

Standard reaction conditions typically include:

ComponentConcentrationFunction
HEPES buffer pH 7.5-8.050-100 mMMaintains optimal pH
MgCl₂2-5 mMProvides essential cofactor
4-hydroxybenzoate0.1-0.5 mMAromatic substrate
Octaprenyl diphosphate0.05-0.2 mMPrenyl donor
DTT or β-mercaptoethanol1-5 mMMaintains reducing environment
Detergent (e.g., DDM)0.01-0.05%Stabilizes membrane protein
Purified ubiA enzyme0.1-5 μgCatalyzes reaction

Reactions are typically conducted at 30-37°C for 15-60 minutes before termination and analysis .

How can site-directed mutagenesis be used to study key residues in ubiA function?

Site-directed mutagenesis represents a powerful approach for elucidating the functional roles of specific amino acid residues in ubiA:

  • Target selection strategy:

    • Focus on conserved aspartate-rich motifs (e.g., DXXXD) known to coordinate Mg²⁺ ions critical for catalysis.

    • Target aromatic residues in predicted substrate binding regions.

    • Investigate residues at the membrane interface that may regulate substrate access.

  • Methodological approach:

    • Employ PCR-based mutagenesis using primers containing the desired nucleotide changes.

    • Use the QuikChange method or overlap extension PCR for introducing mutations.

    • Verify mutations through DNA sequencing before expression.

  • Functional analysis protocol:

    • Express wild-type and mutant proteins under identical conditions.

    • Quantify expression levels via western blotting to ensure comparable protein amounts.

    • Measure enzyme activity using standardized assays to determine the impact of mutations.

    • Perform kinetic analyses to distinguish between effects on substrate binding (Km) versus catalytic efficiency (kcat).

  • Structural interpretation:

    • Map mutations onto predicted structural models based on crystallized homologs.

    • Utilize molecular dynamics simulations to predict how mutations alter protein conformation or substrate interactions.

Common mutations with significant effects include:

  • D→N substitutions in metal-binding motifs typically abolish activity

  • W/F/Y→A mutations in the substrate binding pocket often alter substrate specificity

  • R/K→E substitutions at membrane interfaces can affect protein orientation and substrate access

This approach has successfully identified key catalytic and structural residues in related enzymes and can be applied to understand the precise mechanism of ubiA .

How does ubiA from Pectobacterium carotovorum compare with homologs from other bacterial species?

The ubiA homologs across bacterial species show significant conservation in core functional domains while exhibiting species-specific adaptations:

Key differences observed across bacterial species include:

  • Substrate preference variations:

    • Some species utilize longer or shorter prenyl chains (nonaprenyl vs. octaprenyl)

    • Subtle variations in the binding pocket accommodate these differences

  • Regulatory elements:

    • Promoter regions and transcriptional regulation differ substantially

    • Post-translational modifications vary between species

  • Genomic context:

    • In some bacteria, ubiA is part of operons with other ubiquinone biosynthesis genes

    • In others, including Pectobacterium, it may be independently regulated

These comparative insights can guide the development of species-specific inhibitors and help predict functional divergence in newly sequenced bacterial genomes .

What functional complementation approaches can be used to study ubiA across species?

Functional complementation provides powerful insights into the conservation and divergence of ubiA function across species:

  • Bacterial complementation systems:

    • Generate E. coli ubiA deletion mutants (ΔubiA) that exhibit growth defects under respiratory conditions.

    • Transform these mutants with expression vectors containing ubiA homologs from various species, including Pectobacterium carotovorum.

    • Measure growth restoration under aerobic conditions or with non-fermentable carbon sources.

    • Quantify ubiquinone production to assess enzymatic functionality.

  • Yeast complementation approach:

    • Utilize Saccharomyces cerevisiae coq2 mutants (COQ2 is the yeast ortholog of ubiA).

    • Express bacterial ubiA genes in these mutants under appropriate promoters.

    • Assess respiratory growth on glycerol or ethanol media.

    • Measure coenzyme Q levels by HPLC analysis.

  • Cross-kingdom complementation:

    • As demonstrated in recent research, human UbiA genes can be expressed in Drosophila models, replacing the endogenous heix gene (Drosophila ubiA homolog) .

    • This approach reveals the evolutionary conservation of function across vast phylogenetic distances.

    • Similar studies with bacterial ubiA in human cell lines can identify conserved and divergent functions.

  • Chimeric protein analysis:

    • Create fusion proteins containing domains from ubiA homologs of different species.

    • Express these chimeras in appropriate null mutants.

    • Identify domains responsible for species-specific functions or substrate preferences.

Success rates for complementation across different taxonomic distances:

Donor SpeciesRecipient SystemComplementation EfficiencyNotes
E. coliP. carotovorum~90-95%Closely related species
P. carotovorumE. coli~85-90%Closely related species
Bacterial ubiAYeast (S. cerevisiae)~50-70%Cross-kingdom but conserved function
Human COQ2Bacterial systems~30-50%Requires optimization of expression
Bacterial ubiAHuman cell lines~20-40%May require codon optimization

These approaches have demonstrated that the fundamental catalytic mechanism of ubiA has been conserved throughout evolution, while substrate specificity and regulatory mechanisms have diverged .

How have structural predictions of ubiA evolved with advances in computational biology?

The structural understanding of ubiA has progressed significantly through computational biology advancements:

Early structural predictions (pre-2010) relied primarily on hydropathy analyses and secondary structure predictions, identifying ubiA as a transmembrane protein with multiple membrane-spanning helices. These models correctly predicted the general topology but lacked detailed insights into the catalytic mechanism.

The mid-2010s marked a significant advance with the publication of crystal structures for related UbiA superfamily members, particularly archaeal UbiA prenyltransferase (UBIAD1). These structures revealed a core architecture consisting of 9 transmembrane helices forming a central cavity where catalysis occurs. Two conserved aspartate-rich motifs were confirmed to coordinate magnesium ions essential for catalysis.

Recent developments include:

  • Enhanced homology modeling approaches:

    • Integration of co-evolutionary information through methods like AlphaFold

    • Improved prediction of membrane protein structures through specialized algorithms

    • More accurate modeling of protein-substrate interactions

  • Molecular dynamics simulations:

    • Investigation of protein dynamics within membrane environments

    • Simulation of substrate binding and product release pathways

    • Analysis of water and ion movements during catalysis

  • Quantum mechanics/molecular mechanics (QM/MM) calculations:

    • Detailed modeling of the transition state during the prenylation reaction

    • Prediction of energy barriers for catalysis

    • Identification of key residues involved in lowering activation energy

  • Integration with experimental data:

    • Refinement of models based on site-directed mutagenesis results

    • Incorporation of cross-linking and mass spectrometry data

    • Validation through functional assays of predicted critical residues

Current structural models suggest that bacterial ubiA, including that from Pectobacterium carotovorum, shares the core architectural features with archaeal homologs but exhibits specific adaptations in substrate binding regions that account for differences in prenyl chain length preferences and reaction specificity .

What are the most common challenges in expressing active recombinant ubiA?

Researchers frequently encounter several significant challenges when expressing active recombinant ubiA:

  • Membrane protein solubility issues:

    • As an integral membrane protein, ubiA often aggregates during overexpression.

    • Inclusion body formation is common in bacterial expression systems.

    • Solution: Use specialized membrane protein expression systems like C41/C43(DE3) E. coli strains or consider eukaryotic expression platforms such as S2 cells as described in recent research .

  • Toxicity to host cells:

    • Overexpression of membrane proteins can disrupt host cell membrane integrity.

    • Altered cellular metabolism due to increased ubiquinone production may affect growth.

    • Solution: Employ tightly regulated inducible promoters and optimize induction conditions (lower temperature, reduced inducer concentration, shorter induction time).

  • Improper folding and insertion:

    • Correct membrane topology is essential for activity.

    • Solution: Co-express with molecular chaperones or use fusion partners (such as GFP or MBP) that can report on folding status.

  • Cofactor availability:

    • Mg²⁺ ions are essential for catalytic activity.

    • Solution: Supplement expression media with additional MgSO₄ (2-5 mM) and ensure purification buffers contain appropriate Mg²⁺ concentrations.

  • Substrate limitations:

    • The hydrophobic prenyl diphosphate substrate may be limiting in recombinant systems.

    • Solution: Consider co-expression with prenyl diphosphate synthases or supplement with exogenous substrates.

Researchers have reported success using the PUAST vector system for expression in S2 cells, which resulted in properly folded and active protein that could be detected by western blotting at the expected size of approximately 60 kDa .

How can researchers troubleshoot inactive recombinant ubiA preparations?

When faced with inactive recombinant ubiA preparations, researchers should implement a systematic troubleshooting approach:

  • Protein quality assessment:

    • Verify protein integrity through SDS-PAGE and western blotting to confirm full-length expression without degradation.

    • Utilize size exclusion chromatography to evaluate aggregation state.

    • Perform thermal shift assays to assess protein stability.

  • Detergent optimization:

    • Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations.

    • Consider detergent exchange during purification to find optimal stabilizing conditions.

    • Test detergent:protein ratios to ensure proper micelle formation without stripping essential lipids.

  • Lipid environment restoration:

    • Supplement with E. coli polar lipid extract or specific phospholipids.

    • Reconstitute purified protein into liposomes or nanodiscs.

    • Add cardiolipin, which often stabilizes membrane proteins from bacterial sources.

  • Cofactor and substrate verification:

    • Ensure Mg²⁺ is present at appropriate concentrations (2-5 mM).

    • Verify substrate quality through analytical methods (TLC, HPLC).

    • Test substrate analogs that might have better solubility or stability.

  • Assay conditions optimization matrix:

ParameterRange to TestOptimal Conditions
pH6.5-9.0 in 0.5 incrementsTypically 7.5-8.0
Temperature20-45°COften 30-37°C
Ionic strength50-300 mM NaClUsually 100-150 mM
Reducing agentsDTT, β-ME, TCEP at 0.5-5 mMOften 1 mM DTT
Glycerol0-20%Typically 10%
Mg²⁺ concentration1-10 mMUsually 2-5 mM
  • Expression system reconsideration:

    • If bacterial expression yields inactive protein, transition to eukaryotic systems like S2 cells that have demonstrated success in producing active ubiA proteins .

    • Consider cell-free expression systems that allow direct control of the folding environment.

This methodical approach has successfully resolved inactivity issues in recombinant membrane proteins, including prenyltransferases related to ubiA .

What strategies can overcome the challenges of crystallizing membrane proteins like ubiA?

Crystallizing membrane proteins like ubiA presents significant challenges but can be addressed through several innovative strategies:

  • Construct optimization:

    • Generate truncated versions removing flexible termini while preserving core catalytic domains.

    • Create fusion proteins with crystallization chaperones (T4 lysozyme, BRIL, rubredoxin) inserted into loops.

    • Design thermostabilized variants through alanine-scanning mutagenesis and combination of stabilizing mutations.

  • Advanced detergent approaches:

    • Screen detergent types systematically, focusing on maltoside (DDM, UDM), neopentyl glycol (LMNG), and facial amphiphiles.

    • Utilize detergent mixtures that better mimic native membrane environments.

    • Implement detergent exchange during purification to identify optimal conditions.

  • Alternative membrane mimetics:

    • Employ lipidic cubic phase (LCP) crystallization, which has revolutionized membrane protein structural biology.

    • Utilize nanodiscs or SMALPs (styrene-maleic acid lipid particles) that maintain a more native lipid environment.

    • Consider amphipols as detergent alternatives that wrap around hydrophobic surfaces.

  • Crystal engineering:

    • Use antibody fragments (Fab, nanobodies) to increase polar surface area and promote crystal contacts.

    • Employ surface entropy reduction through mutation of flexible, charged residues (Lys, Glu) to alanine.

    • Create designed ankyrin repeat proteins (DARPins) as crystallization chaperones.

  • Screening optimization:

    • Implement sparse matrix screens specifically designed for membrane proteins.

    • Utilize lipid additives (cholesterol, cardiolipin) known to stabilize specific membrane proteins.

    • Screen crystallization temperatures systematically (4°C, 18°C, room temperature).

  • Alternative structural approaches:

    • Consider cryo-electron microscopy (cryo-EM), which has increasingly provided high-resolution structures of membrane proteins without crystallization.

    • Implement small-angle X-ray scattering (SAXS) to obtain low-resolution envelopes.

    • Use solid-state NMR for specific structural questions about dynamics or substrate binding.

Success has been achieved with related UbiA family members using LCP crystallization combined with fusion protein approaches, suggesting similar strategies may be applicable to Pectobacterium carotovorum ubiA .

How might engineered ubiA variants contribute to improved ubiquinone production?

Engineered ubiA variants offer significant potential for enhancing ubiquinone (coenzyme Q) production through several rational design approaches:

Recent research utilizing the PUAST expression system for ubiA proteins demonstrates the feasibility of producing functional prenyltransferases in heterologous systems, providing a foundation for these engineering approaches .

What is the potential of ubiA as a target for novel antimicrobial development?

The essential nature of ubiA in bacterial ubiquinone biosynthesis positions it as a promising target for novel antimicrobial development:

  • Target validation evidence:

    • Genetic studies demonstrate that ubiA knockout is lethal in many bacterial pathogens under aerobic conditions.

    • Ubiquinone biosynthesis is critical for bacterial respiration and energy production.

    • The pathway is absent in humans, who acquire ubiquinone primarily through diet.

  • Structural basis for selectivity:

    • Despite functional conservation, bacterial ubiA exhibits significant structural differences from human COQ2.

    • The bacterial enzyme typically contains unique binding pockets that can be exploited for selective inhibition.

    • Differences in substrate specificity (octaprenyl vs. decaprenyl) can be leveraged for designing specific inhibitors.

  • Inhibitor development strategies:

    • Substrate analogs that competitively bind to the active site but resist prenylation.

    • Allosteric inhibitors targeting regulatory sites unique to bacterial enzymes.

    • Transition state mimics that bind with high affinity to the catalytic site.

    • Covalent inhibitors targeting non-conserved cysteine residues near the active site.

  • Advantages as an antimicrobial target:

    • Membrane localization reduces the need for inhibitors to penetrate deeply into bacterial cells.

    • Essential nature means resistance is less likely to develop through target elimination.

    • Narrow spectrum potential allows for pathogen-specific targeting based on ubiA sequence variations.

  • Challenges to address:

    • Developing inhibitors with appropriate physicochemical properties to reach the membrane-embedded target.

    • Ensuring selectivity over human prenyltransferases to minimize toxicity.

    • Optimizing pharmacokinetic properties for in vivo efficacy.

The successful cloning and expression of recombinant ubiA, as demonstrated in recent research, provides critical tools for high-throughput screening assays and structural studies that can accelerate antimicrobial discovery efforts focused on this target .

How does research on bacterial ubiA inform our understanding of human prenyltransferase disorders?

Research on bacterial ubiA provides valuable insights into human prenyltransferase disorders through evolutionary and functional comparative analyses:

  • Conserved mechanistic principles:

    • Bacterial and human prenyltransferases share fundamental catalytic mechanisms involving magnesium coordination and aspartate-rich motifs.

    • Understanding bacterial enzymes has illuminated reaction mechanisms applicable across the prenyltransferase family.

    • Bacterial systems provide simpler models for investigating core enzymatic functions without the complexity of human regulatory networks.

  • Disease-relevant insights:

    • Mutations in human UbiA prenyltransferase domain-containing proteins are associated with several disorders:

      • UBIAD1 mutations cause Schnyder corneal dystrophy

      • COQ2 mutations lead to primary coenzyme Q10 deficiency

      • PDSS1/PDSS2 mutations result in mitochondrial disorders

    • Bacterial model systems allow rapid testing of equivalent mutations to understand pathological mechanisms.

  • Therapeutic development platforms:

    • Bacterial expression systems provide efficient platforms for screening compounds that might rescue defective human prenyltransferases.

    • Structural insights from bacterial enzymes inform rational design of molecules to modulate human enzyme activity.

    • The successful recombinant expression of UbiA demonstrated in recent research establishes protocols that can be adapted for human prenyltransferases .

  • Translational research applications:

    • Complementation approaches using human genes in bacterial systems (similar to the UbiA-PUAST system described in the literature) enable functional assessment of patient mutations .

    • High-throughput assays developed for bacterial enzymes can be modified to screen for compounds affecting human orthologs.

    • Insights into substrate specificity determinants help explain why certain mutations affect specific tissues despite ubiquitous expression.

  • Cross-species comparative table of prenyltransferase disorders:

EnzymeSpeciesAssociated DisorderKey SymptomsMechanistic Insight from Bacterial Studies
COQ2HumanPrimary CoQ10 deficiencyEncephalomyopathy, nephropathySubstrate binding mode, prenyl chain length specificity
UBIAD1HumanSchnyder corneal dystrophyCorneal opacificationMembrane topology, cholesterol interaction
PDSS1/2HumanPDSS deficiencyLeigh syndrome, nephrotic syndromeHeterodimer formation, chain elongation mechanism
UbiABacteriaN/A (essential gene)Respiratory deficiency in mutantsBasic catalytic mechanism, active site architecture

This translational understanding demonstrates how bacterial research directly contributes to the comprehension and potential treatment of human genetic disorders .

What emerging technologies could advance ubiA research in the next decade?

Several cutting-edge technologies are poised to revolutionize ubiA research in the coming decade:

  • Cryo-electron microscopy advancements:

    • Single-particle cryo-EM reaching sub-2Å resolution will enable visualization of substrate binding and catalytic intermediates.

    • Time-resolved cryo-EM will capture conformational changes during the catalytic cycle.

    • Focused ion beam milling combined with cryo-electron tomography will allow visualization of ubiA in its native membrane environment.

  • Integrative structural biology approaches:

    • Combining multiple experimental techniques (X-ray crystallography, NMR, cryo-EM, mass spectrometry) with computational modeling.

    • Enhanced prediction through AI-driven tools like AlphaFold2 specifically optimized for membrane proteins.

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions and conformational changes.

  • Advanced genetic engineering tools:

    • CRISPR-Cas systems for precise genomic modification of ubiA in diverse bacterial species.

    • Base editing and prime editing technologies for introducing specific mutations without double-strand breaks.

    • Multiplex genome engineering to simultaneously modify ubiA and related pathway components.

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during catalysis.

    • Optical tweezers combined with fluorescence to correlate mechanical properties with function.

    • Nanopore-based single-molecule detection of enzymatic activity.

  • Microfluidic and lab-on-a-chip platforms:

    • High-throughput screening of thousands of ubiA variants simultaneously.

    • Droplet microfluidics for encapsulating single cells expressing ubiA variants for activity assays.

    • Gradient generators for rapidly optimizing expression and purification conditions.

  • Synthetic biology and cell-free systems:

    • Minimal cell systems containing only essential components for ubiA function.

    • Cell-free expression platforms optimized for membrane protein production.

    • Construction of artificial membrane systems with precisely controlled lipid composition.

The successful expression of UbiA in the PUAST vector system demonstrated in recent research already points toward the application of advanced eukaryotic expression systems for studying bacterial proteins in diverse contexts .

What are the most pressing unanswered questions about ubiA function and regulation?

Despite significant progress, several critical questions about ubiA function and regulation remain unresolved:

  • Structural dynamics during catalysis:

    • How does ubiA undergo conformational changes during substrate binding and product release?

    • What are the rate-limiting steps in the catalytic cycle?

    • How does the enzyme coordinate the binding of two chemically distinct substrates (aromatic and prenyl)?

  • Membrane integration and lipid interactions:

    • How do specific lipids in the bacterial membrane modulate ubiA activity?

    • Which regions of the protein are involved in sensing membrane properties?

    • How does the transmembrane arrangement influence substrate access and product release?

  • Regulatory mechanisms:

    • How is ubiA expression regulated in response to respiratory demands?

    • Are there post-translational modifications that modulate ubiA activity?

    • Does the enzyme form complexes with other ubiquinone biosynthetic enzymes?

  • Species-specific adaptations:

    • Why do some bacterial species utilize different prenyl chain lengths?

    • How have substrate specificities evolved across bacterial lineages?

    • What selective pressures drive the evolution of ubiA in different ecological niches?

  • Integration with cellular metabolism:

    • How is ubiA activity coordinated with other aspects of bacterial energy metabolism?

    • What feedback mechanisms exist between ubiquinone levels and ubiA function?

    • How does the enzyme respond to oxidative stress and changing redox states?

  • Potential moonlighting functions:

    • Does ubiA possess secondary functions beyond ubiquinone biosynthesis?

    • Can it utilize alternative substrates under certain conditions?

    • Does it play roles in stress responses or other cellular processes?

Addressing these questions will require integrating insights from multiple disciplines, including the successful recombinant expression approaches demonstrated in recent research with the PUAST vector system .

How might systems biology approaches enhance our understanding of ubiA in the context of ubiquinone biosynthesis?

Systems biology approaches offer powerful frameworks for contextualizing ubiA within the broader landscape of ubiquinone biosynthesis and cellular metabolism:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data to create comprehensive maps of ubiquinone biosynthesis regulation.

    • Correlating ubiA expression patterns with metabolic fluxes through related pathways.

    • Identifying condition-specific regulatory networks that modulate ubiA activity.

  • Flux balance analysis and metabolic modeling:

    • Constructing genome-scale metabolic models that incorporate detailed ubiquinone biosynthesis pathways.

    • Predicting metabolic consequences of ubiA perturbations under various growth conditions.

    • Identifying potential metabolic engineering targets to enhance ubiquinone production.

  • Protein interaction networks:

    • Mapping physical and functional interactions between ubiA and other proteins.

    • Identifying potential regulatory proteins that modulate ubiA activity.

    • Discovering unexpected connections to other cellular processes.

  • Comparative systems approaches:

    • Analyzing conservation and divergence of ubiquinone biosynthesis regulation across bacterial species.

    • Identifying differential regulation patterns that reflect ecological adaptations.

    • Leveraging cross-species comparisons to predict functional interactions.

  • Synthetic biology implementations:

    • Designing minimal systems containing only essential components for ubiquinone biosynthesis.

    • Creating reporter systems that monitor pathway flux in response to genetic or environmental perturbations.

    • Engineering synthetic regulatory circuits to modulate ubiA expression in response to specific signals.

  • Computational modeling of pathway dynamics:

    • Developing kinetic models of the complete ubiquinone biosynthesis pathway.

    • Simulating the effects of different regulatory mechanisms on pathway flux.

    • Identifying potential rate-limiting steps and regulatory bottlenecks.

The successful expression of UbiA in recombinant systems, as demonstrated in recent research using the PUAST vector, provides essential experimental tools for validating predictions from these systems biology approaches .

What are the key considerations for researchers beginning work with recombinant ubiA?

Researchers initiating work with recombinant Pectobacterium carotovorum ubiA should consider several critical factors to ensure successful outcomes:

  • Expression system selection:

    • Consider the experimental goals when choosing between bacterial and eukaryotic systems.

    • For high-yield protein production, E. coli strains specialized for membrane proteins (C41/C43) may be suitable.

    • For functional studies requiring proper folding and post-translational modifications, eukaryotic systems like S2 cells with the PUAST vector have demonstrated success .

  • Construct design considerations:

    • Include appropriate affinity tags (His6, FLAG) for purification and detection.

    • Consider fusion proteins (GFP, MBP) to monitor expression and enhance solubility.

    • Design primers with appropriate restriction sites (XhoI, XbaI) for efficient cloning .

    • Verify sequence integrity through complete sequencing before expression.

  • Expression optimization:

    • Test multiple induction conditions (temperature, inducer concentration, duration).

    • Supplement growth media with appropriate cofactors (Mg²⁺).

    • Monitor expression through western blotting to identify optimal harvest times.

    • Be prepared to screen multiple colonies for variable expression levels.

  • Purification strategy:

    • Select detergents carefully based on the intended downstream applications.

    • Include protease inhibitors throughout the purification process.

    • Maintain glycerol (10-15%) in all buffers to enhance stability.

    • Consider multiple purification steps to achieve high purity.

  • Activity assay development:

    • Validate enzyme activity using multiple complementary approaches.

    • Ensure availability of both substrates (4-hydroxybenzoate and prenyl diphosphate).

    • Optimize assay conditions systematically (pH, temperature, cofactor concentration).

    • Include appropriate controls to distinguish enzyme-catalyzed from background reactions.

  • Data interpretation caveats:

    • Consider the impact of tags on protein function when interpreting results.

    • Be aware that membrane environment differences may affect activity in heterologous systems.

    • Validate key findings through multiple technical and biological replicates.

By addressing these considerations proactively, researchers can build upon the successful methodologies described in recent literature, such as the UbiA expression in the PUAST vector system .

How has our understanding of ubiA evolved over the past decade?

Over the past decade, our understanding of ubiA has undergone significant evolution across multiple dimensions:

  • Structural insights:

    • Transition from basic topology predictions to detailed structural models based on crystallographic data from related enzymes.

    • Improved understanding of the transmembrane architecture and substrate binding sites.

    • Recognition of conformational changes essential for catalysis.

  • Enzymatic mechanism:

    • Clarification of the precise roles of conserved aspartate residues in metal coordination and catalysis.

    • Improved understanding of substrate binding order and product release steps.

    • Recognition of potential allosteric regulation mechanisms.

  • Evolutionary perspective:

    • Deeper appreciation of the conservation of ubiA across diverse bacterial lineages.

    • Recognition of specialized adaptations in different ecological niches.

    • Understanding of the evolutionary relationships between bacterial ubiA and eukaryotic homologs.

  • Technological advances:

    • Development of improved expression systems, such as the PUAST vector demonstrated in recent research .

    • Implementation of advanced purification strategies for membrane proteins.

    • Application of modern structural biology techniques to related prenyltransferases.

  • Functional context:

    • Recognition of ubiA's integration with broader metabolic networks.

    • Appreciation of regulatory mechanisms coordinating ubiquinone biosynthesis with respiratory demands.

    • Understanding of the consequences of ubiA dysfunction for bacterial fitness.

  • Practical applications:

    • Recognition of ubiA as a potential antimicrobial target.

    • Development of recombinant systems for biotechnological applications.

    • Utilization of bacterial ubiA research to understand human prenyltransferase disorders.

This decade of progress has transformed ubiA from a relatively obscure biosynthetic enzyme to a well-characterized membrane protein with significant implications for basic science, biotechnology, and medicine .

What interdisciplinary approaches might yield the most significant advances in ubiA research?

The most promising future advances in ubiA research will likely emerge from strategic interdisciplinary collaborations:

  • Structural biology and computational chemistry integration:

    • Combining experimental structures with molecular dynamics simulations to understand conformational dynamics.

    • Applying quantum mechanical calculations to elucidate detailed reaction mechanisms.

    • Using machine learning approaches to predict structure-function relationships.

  • Synthetic biology and metabolic engineering synergy:

    • Engineering synthetic ubiquinone biosynthesis pathways with optimized ubiA variants.

    • Creating reporter systems that monitor pathway flux in real-time.

    • Developing cell-free systems optimized for membrane protein production and assay.

  • Chemical biology and enzymology collaboration:

    • Designing activity-based probes to track ubiA in native environments.

    • Developing surrogate substrates with enhanced detection properties.

    • Creating photoaffinity labels to capture transient protein-substrate interactions.

  • Microbiology and systems biology integration:

    • Exploring ubiA function across diverse bacterial species and environments.

    • Mapping global responses to ubiA perturbation through multi-omics approaches.

    • Developing genome-scale models incorporating detailed ubiquinone biosynthesis pathways.

  • Evolutionary biology and biotechnology convergence:

    • Reconstructing ancestral ubiA sequences to understand evolutionary trajectories.

    • Mining extremophile bacteria for ubiA variants with enhanced stability or activity.

    • Applying directed evolution to develop ubiA variants with novel properties.

  • Medicine and microbiology interface:

    • Leveraging bacterial ubiA research to understand human prenyltransferase disorders.

    • Developing selective inhibitors targeting pathogen-specific features of ubiA.

    • Creating diagnostic tools based on ubiquinone pathway markers.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.