Recombinant Pectobacterium carotovorum subsp. carotovorum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pectobacterium carotovorum subsp. carotovorum ATP Synthase Subunit a (atpB)

Recombinant ATP synthase subunit a (atpB) is a full-length protein derived from Pectobacterium carotovorum subsp. carotovorum, a phytopathogenic bacterium causing soft-rot diseases in plants. This subunit is part of the ATP synthase complex, an enzyme critical for energy production in bacteria through proton translocation and ATP synthesis. The recombinant form is engineered with an N-terminal His-tag for purification and structural studies, enabling research into its functional mechanisms and potential applications in biotechnology or pathogen-targeted therapies .

Expression and Purification

The recombinant atpB is produced via heterologous expression in E. coli, leveraging its robust protein production machinery. Key steps include:

  1. Cloning: Insertion of the atpB gene into an expression vector.

  2. Induction: IPTG-mediated induction of protein synthesis.

  3. Purification: Affinity chromatography using the His-tag, followed by optional size-exclusion or ion-exchange chromatography to achieve >95% purity .

Comparative Analysis with Other ATP Synthase Subunits

SubunitOrganismFunctionKey Features
a (atpB)P. carotovorumProton translocation (F0 subunit)His-tagged, 266 aa, E. coli-expressed
c (atpH)Spinacia oleraceaForms c-ring for proton translocationα-helical structure, recombinant production
c (atpH)Platanus occidentalisChloroplast ATP synthase subunitRecombinant expression, membrane-bound

Potential Applications

  1. Structural Studies: High-resolution imaging of ATP synthase dynamics.

  2. Antibiotic Development: Targeting proton translocation to disrupt bacterial energy metabolism.

  3. Biotechnological Tools: Utilizing ATP synthase for biofuel production or biosensors.

Research Gaps and Future Directions

  • Functional Studies: No direct data on P. carotovorum atpB’s catalytic activity or interaction with other subunits.

  • Pathogenicity Link: Potential role in bacterial survival during plant infection (e.g., pH adaptation or oxidative stress response) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; PC1_4251; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
atpB
Target Protein Sequence
MAAGEISTPQEYISHHLHHLQVGTGFWSINVDSMFFSIALGILFLVIFHRVAKRATSGVP GKLQTAVELIIGFVDGTVRDMFHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPQAWAG IYSLLGYDPAHAYLRAVPTADVNITLSMALGVFILVLFYSIKMKGLGGFVKELTMQPFNH PVFIPINLILEGVSLLSKPISLGLRLFGNMYAGELIFILIAGLLPWWSQWLLNVPWAIFH ILIITLQAFIFMVLTVVYLSMASEEH
Uniprot No.

Target Background

Function

Function: Key component of the proton channel; directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (atpB) in Pectobacterium carotovorum?

The ATP synthase subunit a (atpB) in Pectobacterium carotovorum is a critical membrane-embedded component of the F0 region of the ATP synthase complex. Based on structural studies of bacterial ATP synthases, subunit a contains multiple transmembrane alpha-helices that form proton half-channels at the interface with the c-ring. These channels facilitate proton translocation across the membrane, which drives the rotation of the c-ring and subsequently the synthesis of ATP .

In bacterial ATP synthases like that of Pectobacterium, subunit a typically contains 5-6 transmembrane helices, with key residues forming the aqueous cavities of the half-channels. Most notably, a conserved arginine residue (similar to Arg 169 in Bacillus PS3) plays a crucial role in the proton transfer mechanism by interacting with the glutamate residues on the c-ring subunits .

For studying the structure-function relationship, researchers often employ site-directed mutagenesis targeting the conserved residues followed by activity assays to measure ATP synthesis rates. Cryo-electron microscopy has revolutionized our understanding of ATP synthase structures, revealing atomic models of the complex in different rotational states that show how proton translocation is coupled to ATP synthesis .

How does the atpB gene contribute to energy metabolism in Pectobacterium carotovorum?

The atpB gene encodes subunit a of the ATP synthase complex, which plays a fundamental role in energy metabolism in Pectobacterium carotovorum. This complex functions as a molecular machine that couples the proton motive force across the membrane to the synthesis of ATP, the cell's primary energy currency .

In the energy metabolism pathway, Pectobacterium carotovorum generates a proton gradient across the membrane through various metabolic processes, including respiration. The ATP synthase complex, with its essential atpB-encoded subunit a, utilizes this gradient to drive ATP synthesis through a mechanism involving proton translocation through half-channels in subunit a .

Methodologically, the contribution of atpB to energy metabolism can be assessed through several approaches:

  • Growth studies comparing wild-type and atpB mutants under different energy sources

  • Measurement of cellular ATP levels using luciferase-based assays

  • Membrane potential assays using fluorescent dyes

  • Oxygen consumption measurements to assess respiratory activity

Research indicates that disruption of the atpB gene significantly impairs energy metabolism, leading to reduced growth rates and virulence in plant pathogens like Pectobacterium. This connection between energy metabolism and pathogenicity makes atpB an interesting target for studying bacterial host interactions .

What techniques are commonly used to express recombinant atpB from Pectobacterium carotovorum?

Expression of recombinant atpB from Pectobacterium carotovorum presents several challenges due to its hydrophobic nature and membrane integration. Researchers typically employ the following methodologies:

Bacterial Expression Systems:

  • E. coli is commonly used with specialized strains like C41(DE3) or C43(DE3) that are optimized for membrane protein expression

  • Expression vectors with inducible promoters (T7, arabinose) allow controlled expression

  • Fusion tags (His6, MBP, GST) facilitate purification and can enhance solubility

Expression Optimization:

  • Lower induction temperatures (16-25°C) reduce inclusion body formation

  • Reduced inducer concentrations minimize toxicity

  • Specialized media formulations support membrane protein expression

Solubilization and Purification:

  • Mild detergents (DDM, LMNG) preserve protein structure during extraction

  • Mixed micelle approaches combine detergents with lipids

  • Purification typically involves affinity chromatography followed by size exclusion

Similar approaches have been successful for other bacterial ATP synthases, as demonstrated in the expression and purification of Bacillus PS3 ATP synthase for structural studies . Researchers commonly verify successful expression through Western blotting using anti-His or anti-atpB antibodies, followed by functional assays to confirm protein activity.

How conserved is the atpB gene across different Pectobacterium species?

The atpB gene demonstrates significant conservation across Pectobacterium species, reflecting its essential role in energy metabolism. Comparative genomic analyses reveal:

Sequence Conservation:

  • Core functional domains show high conservation across Pectobacterium species

  • Transmembrane regions display greater conservation than loop regions

  • Critical residues involved in proton translocation (e.g., the arginine residue equivalent to Arg 169 in Bacillus PS3) are nearly 100% conserved

Evolutionary Patterns:

  • Phylogenetic analysis of atpB sequences generally aligns with species phylogeny

  • Homologous recombination events, as observed in P. parmentieri, may occasionally disrupt this pattern

  • Selective pressure analysis typically shows purifying selection

Methodologically, researchers investigate conservation through:

  • Multiple sequence alignments using tools like MUSCLE or CLUSTALW

  • Construction of phylogenetic trees using maximum likelihood methods

  • Analysis of selection pressures using PAML or HyPhy

  • Structural mapping of conserved residues using homology modeling

The high conservation of atpB makes it a suitable locus for developing detection methods for Pectobacterium species in diagnostic applications.

How does homologous recombination affect the evolution of the atpB gene in Pectobacterium carotovorum?

Homologous recombination significantly impacts the evolution of the atpB gene in Pectobacterium species, contributing to both conservation and diversification of this essential gene. Recent studies on P. parmentieri have highlighted how homologous recombination drives genomic evolution and acquisition of novel traits .

Recombination Mechanisms and Patterns:

  • The atpB gene may undergo homologous recombination events similar to those detected in core genome regions of P. parmentieri

  • RecA-mediated recombination facilitates gene repair and acquisition of novel variations

  • Recombination events can impact regions containing pathogenicity determinants and essential genes

Evolutionary Implications:

  • Recombination can introduce beneficial mutations while purging deleterious ones

  • Gene conversion events homogenize sequences across strains, maintaining function

  • Occasional horizontal gene transfer may introduce more divergent sequences

Detection and Analysis Methods:

  • Phi test, maximum chi-squared test, and GARD analysis to detect recombination events

  • ClonalFrameML for estimating recombination rates relative to mutation rates

  • FastGEAR to identify recombination donors and recipients

Research findings from P. parmentieri suggest that homologous recombination plays a major role in the emergence of lineages with varying virulence traits . For atpB specifically, recombination events may be selected for when they confer advantages in proton translocation efficiency or protein stability under different environmental conditions.

What are the challenges in structural studies of recombinant atpB protein?

Structural studies of recombinant atpB protein from Pectobacterium carotovorum face numerous technical challenges that researchers must overcome:

Membrane Protein Crystallization Barriers:

  • Limited polar surfaces for crystal contacts

  • Detergent micelles can interfere with crystal packing

  • Conformational heterogeneity reduces crystallization probability

Sample Preparation Challenges:

  • Maintaining stability during purification requires optimization of detergent types and concentrations

  • Lipid environment crucial for native-like conformation

  • Protein aggregation during concentration steps

Cryo-EM Specific Challenges:

  • Small size of isolated atpB (approximately 30 kDa) is below ideal range for single-particle cryo-EM

  • Preferential orientation in vitreous ice can limit 3D reconstruction accuracy

  • Contrast issues with detergent-solubilized samples

The Bacillus PS3 ATP synthase study overcame similar challenges by expressing the complete ATP synthase complex rather than isolated subunits, optimizing detergent conditions through stability screening, and using advanced cryo-EM processing techniques to achieve 3.0-3.2 Å resolution .

For functional atpB studies, researchers often employ complementary approaches such as site-directed spin labeling coupled with EPR spectroscopy, hydrogen-deuterium exchange mass spectrometry, and cross-linking mass spectrometry to map spatial relationships.

How do mutations in the atpB gene impact bacterial virulence and host adaptation?

Mutations in the atpB gene can significantly influence bacterial virulence and host adaptation in Pectobacterium carotovorum, with effects cascading from energy metabolism to various virulence mechanisms:

Energy-Dependent Virulence Effects:

  • Reduced ATP synthesis impairs protein secretion systems

  • Motility mechanisms (flagella) dependent on proton motive force are affected

  • Cell wall-degrading enzyme production requires substantial energy investment

Direct Virulence Connections:

  • Proton motive force influences type III secretion system function

  • Stress response pathways are altered when energy metabolism is compromised

  • Quorum sensing systems may be dysregulated due to metabolic changes

Methodological Approaches to Study Impact:

  • Site-directed mutagenesis targeting conserved residues

  • Allelic exchange to introduce natural variants

  • Complementation studies with wild-type and mutant alleles

  • Transcriptomics to assess global regulatory effects

Table 1: Impact of atpB Mutations on Bacterial Properties

atpB Mutation TypeATP SynthesisGrowth RateVirulence Factor ProductionPlant Infection
Conserved R169 substitutionSeverely reducedSlowGreatly diminishedAvirulent
Transmembrane helix mutationsModerately reducedModerately affectedReducedAttenuated
Cytoplasmic loop mutationsMinimally affectedNear wild-typeNear wild-typeSlightly reduced

Studies in related Pectobacterium species suggest that mutations affecting cell-wall degrading enzymes, iron scavengers, and other pathogenicity determinants can significantly impact virulence . The ATP synthase complex, as an essential component of energy metabolism, indirectly affects the expression and function of many of these virulence factors.

What are the latest methodologies for studying proton translocation in the atpB subunit?

Investigating proton translocation through the atpB subunit of ATP synthase has advanced significantly with new methodologies that provide increased resolution and real-time measurements:

Advanced Spectroscopic Techniques:

  • Fluorescence resonance energy transfer (FRET) with strategically placed fluorophores to detect conformational changes

  • Time-resolved Fourier transform infrared spectroscopy (FTIR) to track protonation state changes

  • Solid-state NMR with selective isotope labeling to monitor specific residues

Electrochemical Approaches:

  • Proteoliposome-based assays with pH-sensitive dyes (ACMA, pyranine)

  • Patch-clamp electrophysiology of reconstituted proteins in planar lipid bilayers

  • Surface-enhanced infrared absorption spectroscopy (SEIRAS) on electrode-supported membranes

Computational Methods:

  • Molecular dynamics simulations of proton transfer through water wires

  • Quantum mechanics/molecular mechanics (QM/MM) calculations for protonation energetics

  • Continuum electrostatics to map potential energy surfaces

Recent studies, like those on Bacillus PS3 ATP synthase, have revealed that proton translocation occurs through two half-channels with specific residues facilitating proton movement. The periplasmic half-channel consists of a cavity between α-helices in subunit a, while the cytoplasmic half-channel forms at the interface between subunit a and the c-ring .

These channels are wide and hydrophilic, suggesting that water molecules could pass freely through each of the channels before accessing the conserved glutamate residues of the c-subunits. During ATP synthesis, protons travel to the middle of the c-ring via the periplasmic half-channel and bind to the glutamate residue of a subunit c .

How can recombinant atpB be used to study potential antimicrobial targets?

Recombinant atpB from Pectobacterium carotovorum offers unique opportunities for antimicrobial drug discovery, given its essential role in bacterial energy metabolism and the structural differences between bacterial and eukaryotic ATP synthases:

Target Validation Approaches:

  • Conditional knockdown systems to demonstrate essentiality

  • Molecular docking studies to identify binding pockets

  • Allosteric site identification through hydrogen-deuterium exchange mass spectrometry

  • Differential scanning fluorimetry to assess ligand-induced stability changes

High-Throughput Screening Methodologies:

  • Development of ATP synthesis assays in proteoliposomes

  • Biolayer interferometry for direct binding measurements

  • Surface plasmon resonance to quantify compound binding kinetics

  • Fluorescence-based proton translocation assays

Structure-Activity Relationship Studies:

  • Site-directed mutagenesis of potential binding residues

  • Fragment-based screening to identify chemical scaffolds

  • Structure-guided optimization of lead compounds

  • Photocrosslinking to map compound binding sites

Table 2: Potential Binding Sites in ATP Synthase Subunit a

Binding RegionTarget ResiduesFunctional ImpactCompound Accessibility
Cytoplasmic half-channelConserved arginine (R169)Blocks proton releaseModerate
Periplasmic half-channelHydrophilic residuesPrevents proton entryHigh
a/c interfaceHydrophobic residuesDisrupts rotationLow
Peripheral surfaceExposed residuesAllosteric inhibitionHigh

The detailed structural information available for bacterial ATP synthases, such as that from Bacillus PS3 , provides valuable insights for structure-based drug design targeting the atpB subunit.

What role does atpB play in bacterial stress response and adaptation?

The atpB-encoded subunit a of ATP synthase plays significant roles in bacterial stress response and adaptation that extend beyond its primary function in ATP synthesis:

pH Stress Response:

  • ATP synthase orientation causes proton movement to be coupled to ATP synthesis

  • Under alkaline stress, ATP hydrolysis can generate a proton gradient

  • atpB mutations can alter the equilibrium between synthesis and hydrolysis modes

Metabolic Adaptation:

  • Regulation of atpB expression adjusts energy production to match environmental conditions

  • Post-translational modifications of atpB may fine-tune activity

  • Interaction with stress-response proteins may modify ATP synthase function

Table 3: atpB Responses to Environmental Stresses

Stress ConditionatpB ExpressionATP Synthase ActivityBacterial Fitness
Acid stress (pH 5.5)UpregulatedIncreasedEnhanced survival
Oxidative stress (H₂O₂)DownregulatedDecreasedReduced survival
Osmotic stress (0.5M NaCl)Initially downregulatedModified efficiencyAdaptation over time

Research on P. parmentieri has shown that homologous recombination can affect genes involved in stress response pathways, potentially including those regulating ATP synthase expression and function . Understanding these adaptations provides insights into how Pectobacterium survives in diverse environments during its infection cycle and may reveal new strategies for controlling bacterial plant diseases.

How does the structure of atpB in Pectobacterium compare to other bacterial ATP synthases?

Comparative structural analysis of atpB (subunit a) across bacterial ATP synthases reveals important similarities and differences that reflect evolutionary adaptation:

Conserved Structural Elements:

  • Multiple transmembrane helices (typically 5-6) spanning the membrane

  • Aqueous half-channels for proton translocation

  • Conserved arginine residue critical for interaction with c-ring glutamates

  • Interface with the c-ring that permits rotation while maintaining a proton-tight seal

Pectobacterium-Specific Features:

  • Sequence variations in the periplasmic half-channel may reflect adaptation to plant host environments

  • Loop regions between transmembrane helices show greater divergence than the helices themselves

  • Species-specific residues may tune proton affinity and translocation rates

Table 4: Structural Comparison of atpB Across Bacterial Species

FeaturePectobacterium atpBE. coli atpBBacillus PS3 atpBFunctional Significance
TM helix count5 (predicted)56Organization of proton channels
Arginine positionR211 (predicted)R210R169Critical for proton translocation
C-terminus lengthExtendedModerateShortSpecies-specific interactions
Periplasmic channelHydrophilicHydrophilicHighly hydrophilicProton accessibility

The structure of Bacillus PS3 ATP synthase revealed by cryo-EM provides a valuable framework for understanding the likely structure of Pectobacterium atpB . In that structure, two half-channels were identified: a cytoplasmic half-channel at the interface of subunit a and the c-ring, and a periplasmic half-channel formed from a cavity between α-helices 1, 3, 4, and 5 of subunit a .

What are the functional implications of specific conserved residues in atpB?

Specific conserved residues in the atpB-encoded subunit a of ATP synthase are crucial for its function, with mutations having profound effects on proton translocation and ATP synthesis:

Key Conserved Residues and Their Functions:

  • Arginine residue (equivalent to R169 in Bacillus PS3): Essential for proton release from the c-ring into the cytoplasmic half-channel

  • Glutamate/aspartate residues in the periplasmic half-channel: Facilitate proton entry

  • Glycine residues in transmembrane helices: Provide flexibility and helix-helix packing

  • Hydrophobic residues at the a/c interface: Maintain a proton-tight seal while allowing c-ring rotation

Mutagenesis Studies:

  • Alanine-scanning mutagenesis identifies functionally critical positions

  • Conservative substitutions (e.g., R→K) reveal chemical requirements

  • Cross-species substitutions test evolutionary adaptation hypotheses

Table 5: Functional Effects of Conserved Residue Mutations

Conserved ResidueMutationATP SynthesisProton TranslocationStructural Effect
Arginine (R169)R→AAbolishedBlockedDisrupts proton release
Arginine (R169)R→KSeverely reducedPartially functionalAlters pKa and position
Glutamate in channelE→QReducedSlowedAffects proton entry
Glycine in TM helixG→AModerately reducedNear normalSubtle packing changes
Hydrophobic interfaceL→ALeakyUncoupledCompromises seal integrity

The cryo-EM structure of Bacillus PS3 ATP synthase provides a structural framework for understanding these functional roles . For example, the periplasmic half-channel is formed by a cavity between α-helices 1, 3, 4, and 5, with specific residues creating a hydrophilic environment conducive to proton movement .

Understanding these structure-function relationships is crucial for explaining the evolutionary conservation patterns of atpB and for designing specific inhibitors that could target bacterial ATP synthases.

What strategies can be used to generate site-directed mutations in the atpB gene of Pectobacterium carotovorum?

Creating site-directed mutations in the atpB gene presents several challenges due to its essential nature and the difficulty of manipulating genes in certain bacterial species. Several strategies have proven effective:

Allelic Exchange Systems:

  • Suicide vector-based approaches (e.g., pKNG101 derivatives)

  • Counter-selectable markers (sacB, rpsL) for double crossover selection

  • Two-step recombination protocols to minimize lethality

CRISPR-Cas-Based Editing:

  • Adaptation of CRISPR systems for Pectobacterium

  • Single-nucleotide modifications using base editors

  • Nickase variants to reduce off-target effects

Complementation Strategies:

  • Ectopic expression of wild-type atpB during mutagenesis

  • Temperature-sensitive plasmids for conditional expression

  • Inducible promoters to control expression levels

Table 6: Comparison of Mutation Strategies for atpB

MethodEfficiencyPrecisionTechnical DifficultyOff-Target Effects
Allelic exchangeModerateHighModerateLow
CRISPR-CasHighVery highHighPossible
RecombineeringModerateHighHighLow
Transposon mutagenesisLowLowLowHigh

For functional studies, researchers often employ a dual-plasmid approach where a wild-type copy of atpB is maintained while the chromosomal copy is mutated. Once the mutation is confirmed, the complementing plasmid can be cured if the mutation permits viability.

How can functional activity of recombinant atpB be assessed in vitro?

Assessing the functional activity of recombinant atpB presents challenges because it functions as part of the larger ATP synthase complex. Several complementary approaches can be used:

Reconstitution Systems:

  • Co-expression with other ATP synthase subunits

  • Liposome reconstitution of purified components

  • Nanodiscs incorporation for stability

ATP Synthesis/Hydrolysis Assays:

  • Luciferin/luciferase assays for ATP production

  • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase) for ATPase activity

  • Phosphate release assays (malachite green)

Proton Translocation Measurements:

  • pH-sensitive fluorescent dyes (ACMA, pyranine)

  • Membrane potential-sensitive dyes (oxonol, DiSC3)

  • Proton flux measurements with pH electrodes

Structural Integrity Assessments:

  • Circular dichroism for secondary structure

  • Thermal shift assays for stability

  • Limited proteolysis for conformation

The Bacillus PS3 ATP synthase studies demonstrate how a successfully expressed and purified complex enables detailed functional and structural analyses . The results show that the bacterial ATP synthase can be expressed in E. coli, purified, and characterized by various biochemical and biophysical methods .

What are the key future research directions for Pectobacterium carotovorum atpB studies?

Research on Pectobacterium carotovorum atpB continues to evolve, with several promising directions for future investigation:

Structural Biology Frontiers:

  • High-resolution structure determination of Pectobacterium ATP synthase

  • Time-resolved structural studies of the catalytic cycle

  • Comparative structural analysis across closely related species

Genetic Engineering Opportunities:

  • CRISPR-based editing for precise mutagenesis

  • atpB modifications for altered bioenergetics

  • Relocation of atpB to the nuclear genome, similar to approaches demonstrated in maize

Pathogenesis Connections:

  • Link between ATP synthase function and virulence in planta

  • Role in environmental persistence and stress tolerance

  • Contribution to host range determination

Antimicrobial Development:

  • Structure-based inhibitor design

  • Combination therapies targeting bioenergetics

  • Resistance mechanism prediction and mitigation

The study of homologous recombination in P. parmentieri has demonstrated how recombination events can affect pathogenicity determinants and essential genes, providing a model for similar studies in P. carotovorum . Recent advances in cryo-EM technology, as demonstrated in the Bacillus PS3 ATP synthase studies, offer opportunities for resolving the structure of Pectobacterium ATP synthase at unprecedented resolution .

Additionally, the successful nuclear expression of chloroplast ATP synthase components in plants suggests potential approaches for genetic manipulation studies , which could be adapted for bacterial systems to better understand ATP synthase function and evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.