Recombinant Pectobacterium carotovorum subsp. carotovorum Bifunctional protein aas (aas)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aas; PC1_3463; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-chain-fatty-acid--[acyl-carrier-protein] ligase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-723
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
aas
Target Protein Sequence
MIHTLLRWVFQRLYRIRIEGDSSQFQQSKLLITPNHVSFLDGILLALFLPIKPVFAVYSS ISDRWFMRWLKPYIDFVPLDPTKPLAIKGLIKVIERGQPVVVFPEGRISVTGSLMKIYSG AAFVAAKSGATIIPVRIDGAEFTPFGRLAGVFKRRCFPQITITYLPPTTLPMPEADSART RRALAGEHLHQIMMKARMETRPQHTLYEAFLAARTRYGRRSPSIADISFNEDSYQGLLKK SLGVSRILQRFTRADEHVGMLLPNATITAASILGASLRNRIPAMLNYTAGAKGLQSAMKA AGIKTIVTSRQFLEKGKLTDLPKQVSEANWVYLEDLKDTVTLADKLWILFHLLFPARAML PQKPDDAAIVLFTSGSEGNPKGVVHSHDSLLANVEQIRTVADFTPRDRFMSALPLFHAFG LTVGLLTPLMTGARIFLYPSPLHYRIVPELVYDQNCTVLFGTSTFLGNYARFAHPYDFAR LRYVVAGAEKLSETTRQVWQDKFGIRILEGYGVTECAPVVAINVPMATKIHSVGLLLPEI ESRLITVPGITRGGRLQLRGPNIMKGYLRVENPGVLEAPAAENAEGELQQGWYDTGDIVE LDEKGFCTIIGRVKRFAKLAGEMVSLESVEQLAVKVSPEAQHAASAKSDSSKGEALVLFT TDSQITRDVLLAQARSSGVPELAVPRDIRYVKALPLLGSGKPDFVTLRHMAEEPVTNASE QSA
Uniprot No.

Target Background

Function

This bifunctional protein plays a crucial role in lysophospholipid acylation. It catalyzes the transfer of fatty acids to the 1-position of lysophospholipids via an enzyme-bound acyl-ACP intermediate, requiring ATP and magnesium. Its physiological function involves regenerating phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE), a product of transacylation reactions or phospholipase A1 degradation.

Database Links
Protein Families
2-acyl-GPE acetyltransferase family; ATP-dependent AMP-binding enzyme family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Bifunctional protein Aas from Pectobacterium carotovorum?

Bifunctional protein Aas is a full-length protein (1-723 amino acids) found in Pectobacterium carotovorum subsp. carotovorum. The recombinant version is typically expressed with an N-terminal His-tag in E. coli expression systems. The protein is cataloged with the UniProt identifier C6DE43 . Structurally, the protein contains multiple functional domains that enable it to perform dual catalytic activities, making it a true bifunctional protein. As part of the bacteriocin family produced by P. carotovorum, the Aas protein shares some functional similarities with other characterized bacteriocins from this species, such as Carocin S4 and Carocin D, which function as nucleases targeting DNA .

What expression systems are commonly used for producing recombinant Aas protein?

Expression of recombinant Aas protein is most commonly achieved using E. coli systems, as evidenced by commercial production methods . For optimal expression, researchers should consider:

  • Vector selection: pGEM-T Easy and similar vectors have been successfully used for bacteriocin genes from P. carotovorum

  • Host strain: DH5α is frequently used as a non-bacteriocin-producing strain for expression

  • Tagging strategy: N-terminal His-tagging facilitates purification while preserving function

For enhanced expression, double-promoter expression systems (DPES) can be employed to increase yield. These systems utilize hybrid-architectured promoters that provide fine-tuned regulation of gene expression. Similar approaches with P. pastoris in methanol-free media have demonstrated enhanced protein expression that may be adaptable to Aas protein production .

How should recombinant Aas protein be stored and reconstituted for experimental use?

For optimal stability and activity of recombinant Aas protein:

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%)

  • Aliquot for long-term storage at -20°C/-80°C

The recommended storage buffer is Tris/PBS-based with 6% Trehalose at pH 8.0, which helps maintain protein stability during freeze-thaw cycles .

What are the similarities and differences between Aas protein and other bacteriocins from P. carotovorum?

The P. carotovorum bacteriocin family includes several characterized members with both similarities and distinct properties:

BacteriocinMolecular WeightNuclease ActivityTarget SpecificityMetal Ion RequirementsOptimal Temperature
Aas Protein~80 kD (estimated)DNase (presumed)Not fully characterizedNot fully characterizedNot fully characterized
Carocin S4 (CaroS4K)~90 kDDNaseGenomic and plasmid DNAMg²⁺, Ca²⁺, Zn²⁺50°C
Carocin S1 (CaroS1K)Similar to S4DNaseGenomic DNA onlySimilar to S4Not reported
Carocin DSimilar rangeDNaseDNALess heat toleranceNot reported

While most P. carotovorum bacteriocins function as nucleases, they differ in their specific activity and target range. Carocin S4 can hydrolyze both genomic and plasmid DNA, unlike Carocin S1 which targets only genomic DNA . Carocin bacteriocins typically consist of killer proteins (K) and immunity proteins (I) that work in tandem, with the latter protecting the producing strain from self-destruction .

What are the optimal conditions for assessing the DNase activity of recombinant Aas protein?

Based on studies of similar bacteriocins from P. carotovorum, the following methodological approach is recommended for assessing DNase activity of recombinant Aas protein:

Reaction conditions:

  • Temperature: Begin testing at 50°C, as this is the optimal temperature for CaroS4K activity

  • Buffer composition: Include divalent metal ions Mg²⁺, Ca²⁺, and Zn²⁺ as cofactors, which are required for DNase activity in similar bacteriocins

  • Substrate selection: Use both genomic DNA and plasmid DNA as substrates to determine specificity

  • pH range: Test in range of pH 5.5-8.0, typical for nuclease activity

Experimental protocol:

  • Prepare reaction mixtures containing purified recombinant Aas protein (0.1-10 µg)

  • Add substrate DNA (0.5-1 µg)

  • Include buffer with appropriate metal ions (1-5 mM)

  • Incubate at various temperatures (30-60°C) for 15-60 minutes

  • Analyze DNA degradation by agarose gel electrophoresis

  • Quantify DNase activity using densitometry or fluorescence-based assays

For controls, include heat-inactivated protein, metal chelation (EDTA) conditions, and comparison with commercial DNases .

What strategies can be employed to engineer bifunctional protein complexes using Aas protein for biosensing applications?

Engineering bifunctional protein complexes with Aas requires consideration of both structural domains and functional properties. Based on recent advances in protein engineering, the following strategies are recommended:

  • Coordinate-mediated peptide assembly:

    • Utilize the His-tag already present on recombinant Aas for coordinate binding with metal ions

    • Engineer peptide linkers that can assemble with the Aas protein while maintaining both functions

    • This approach avoids complex genetic fusion and maintains protein stability

  • Reporter protein coupling:

    • Similar to GFP engineering approaches, Aas can be coupled with fluorescent reporters

    • The protein complex can be designed to facilitate both target recognition and signal reporting

    • This strategy enables sensitive detection systems with substantial loading of functional components

  • Hybrid-architectured expression systems:

    • Employ double-promoter expression systems (DPES) for co-expression of Aas with complementary proteins

    • Use promoter variants like PADH2-Cat8-L2 and PmAOX1 for fine-tuned expression

    • This approach can enhance functional protein yield and activity

The most promising approach combines elements from all three strategies, using coordinate-mediated assembly to link Aas with reporter proteins while employing optimized expression systems .

How does the protein structure of Aas contribute to its bifunctional properties, and what are the implications for protein engineering?

The bifunctional nature of Aas protein is directly related to its structural organization:

Structural analysis of Aas protein domains:

  • The complete 723 amino acid sequence suggests multiple functional domains

  • N-terminal region likely contains translocation domains similar to those found in E. coli colicin E3 and P. aeruginosa S-type pyocin

  • C-terminal region probably contains the catalytic domain responsible for DNase activity

  • Middle region may function as a receptor-binding domain for target cell recognition

Analysis of the amino acid sequence reveals a complex tertiary structure with distinct modules that enable different functions. The structure-function relationship can be exploited for protein engineering through:

  • Domain swapping: Exchanging functional domains with other bacteriocins to create chimeric proteins with novel activities

  • Site-directed mutagenesis: Modifying key residues in the catalytic domain to alter substrate specificity or activity

  • Rational design: Engineering new functions by introducing novel domains while preserving the original bifunctional properties

These approaches can lead to novel bifunctional proteins with enhanced properties for biosensing, biocatalysis, or therapeutic applications.

What are the current challenges in expressing functional recombinant Aas protein, and how can they be overcome?

Expression of bifunctional proteins like Aas presents several challenges:

Challenge 1: Protein folding and stability

  • Solution: Optimize expression temperature (typically lower temperatures of 16-25°C) to allow proper folding

  • Solution: Include molecular chaperones as co-expression partners

  • Solution: Add stabilizing agents like trehalose (6%) to storage buffers

Challenge 2: Amino acid bottlenecks

  • Challenge: The synthesis of specific amino acids may create rate-limiting bottlenecks in recombinant protein synthesis

  • Solution: Supplement growth media with limiting amino acids or use enriched media formulations

  • Solution: Engineer expression hosts with enhanced amino acid biosynthetic pathways

Challenge 3: Bifunctional domain interference

  • Challenge: Different functional domains may interfere with each other during folding

  • Solution: Introduce flexible linker sequences between domains

  • Solution: Express domains separately and use in vitro assembly strategies

Challenge 4: Low yield and solubility

  • Solution: Use double-promoter expression systems (DPES) for enhanced expression

  • Solution: Optimize codon usage for the expression host

  • Solution: Employ solubility tags in addition to purification tags

How can immunity proteins be used to engineer resistance to Aas protein in target organisms, and what are the methodological considerations?

Engineering resistance to Aas protein through immunity proteins involves understanding the killer-immunity protein relationship. Based on studies of similar bacteriocins from P. carotovorum:

Methodology for engineering resistance:

  • Identify and isolate the immunity gene associated with Aas protein (analogous to caroS4I for Carocin S4)

  • Clone the immunity gene into an appropriate expression vector

  • Transform the target organism with the immunity gene construct

  • Select transformants on media containing the bacteriocin

  • Verify resistance through growth inhibition assays

Key considerations:

  • Immunity proteins are typically small (approximately 10 kDa) and function by binding to and inhibiting the killer protein

  • Expression levels must be sufficient to neutralize the killer protein activity

  • The immunity protein must be correctly folded and localized within the cell

  • Cross-immunity between different bacteriocins should be evaluated to understand specificity

The caroS4I gene (270 bp) from Carocin S4 provides a model for immunity protein studies, as transformation with this gene renders sensitive bacteria resistant to bacteriocin attack. Similar approaches would likely work for engineered resistance to Aas protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.