Recombinant Pectobacterium carotovorum subsp. carotovorum Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
clsA; cls; PC1_1991; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
clsA
Target Protein Sequence
MSTFYTVISWLLVFGYWLLIAGVTLRILMKRRAVPSAMAWLLVIYILPLVGIVAYLSFGE LHLGKRRAERASKMWPSTAKWLRELKEYRRIFATENSEVASALFQLCERRQGVGGVKGNQ LQLMTTFDDTIKALLRDIELARSNIEMVFYIWQPGGLVEQVSSSLIAAARRGVHCRILLD SAGSVQFFRQHHPELMRTAGIEVVEALKVNLFRAFLRRMDLRQHRKIILIDNRIAYTGSM NMVDPRFFKQDAGVGQWIDLMARIEGPVATTLGIIYCCDWEMETGKRLLPPPPDVNVMPF EQESGHTIQVIASGPGYPEEMIHQALLTSVYSARKQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPHKNDSVLVGWASRAFFTELLAAGVKIYQFKDGLLHTKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDAGFGSDLACVQEDYIARSRLLNATQWQNRPYWQRIVERLFY FFSPLL
Uniprot No.

Target Background

Function

Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the general mechanisms of cardiolipin synthesis in bacteria?

In most bacteria, cardiolipin synthesis occurs via two main pathways. The first mechanism, common in gram-negative bacteria like Escherichia coli, involves transferring a phosphatidyl group from one phosphatidylglycerol (PG) molecule to another PG molecule, releasing a glycerol molecule. This reaction is catalyzed by cardiolipin synthases of the ClsA and ClsB types . An alternative synthesis method identified in E. coli uses phosphatidylethanolamine (PE) together with PG to form cardiolipin and ethanolamine . These mechanisms differ from the eukaryotic pathway, which uses cytidine diphosphate diacylglycerol (CDP-DAG) and PG as substrates, releasing cytidine monophosphate (CMP) . The bacterial transesterification mechanism is potentially relevant for understanding Pcc cardiolipin synthase function, though specific studies on Pcc cls mechanisms are needed for confirmation.

How do recombinant expression systems for Pcc proteins typically work?

Recombinant expression of Pcc proteins typically involves gene isolation from chromosomal DNA, cloning into appropriate expression vectors, and transformation into host cells like E. coli. For example, the carocin S4 gene was isolated as a 2750 bp fragment from Pcc strain rif-TO6, containing both caroS4K and caroS4I genes encoding killer and immunity proteins, respectively . After isolation, the genes were inserted into a pGEM-T Easy vector to create the pGS4KI construct, which was then transformed into competent E. coli DH5α cells . Similar approaches might be applicable for recombinant expression of Pcc cardiolipin synthase, starting with the isolation of the cls gene from Pcc genomic DNA, followed by vector construction and transformation into a suitable host. Confirmation of recombinant protein expression often involves techniques like Southern blotting, as was done with the carocin S4 gene .

What expression systems are optimal for recombinant Pcc cardiolipin synthase?

Based on successful expression strategies for other Pcc proteins, E. coli-based expression systems appear promising for recombinant Pcc cardiolipin synthase. The DH5α strain has been used successfully for the expression of bacteriocins from Pcc . For membrane proteins like cardiolipin synthase, specialized E. coli strains such as C41(DE3) or C43(DE3), which are designed for membrane protein expression, might yield better results. Expression conditions should be optimized with consideration for protein solubility and activity. For example, lower induction temperatures (16-25°C) and reduced IPTG concentrations might help maintain proper folding of the enzyme. Drawing from studies of archaeal cardiolipin synthase (MhCls), which was successfully overexpressed in E. coli and purified for characterization by LC-MS , similar approaches could be adapted for Pcc cls.

What are the expected substrate specificities of Pcc cardiolipin synthase?

While specific data on Pcc cardiolipin synthase substrate specificity is limited, insights can be drawn from other bacterial and archaeal cardiolipin synthases. For instance, the archaeal cardiolipin synthase from Methanospirillum hungatei (MhCls) shows remarkable substrate promiscuity. It can utilize archaetidylglycerol to produce archaeal di-phosphate cardiolipin (aDPCL), phosphatidylglycerol to generate bacterial di-phosphate cardiolipin (DPCL), and interestingly, can even form hybrid archaeal-bacterial cardiolipin when both substrates are present . This enzyme appears invariant to the stereochemistry of the glycerol backbone and the nature of the lipid tail . By analogy, Pcc cardiolipin synthase might exhibit substrate flexibility, potentially accepting various phospholipid substrates. Experimental determination would require incubating the purified enzyme with different potential substrates and analyzing the products using LC-MS or other analytical techniques.

What structural domains characterize bacterial cardiolipin synthases and how might they appear in Pcc cls?

Bacterial cardiolipin synthases typically contain conserved structural domains responsible for substrate binding and catalysis. Drawing parallels from studies of bacteriocins like Carocin D, which has distinct functional domains (including N-terminal and C-terminal translocation domains homologous to E. coli colicin E3 and Pseudomonas aeruginosa S-type pyocin, respectively ), Pcc cardiolipin synthase likely contains specific domains for membrane association and catalysis. The catalytic domain would be expected to contain conserved residues involved in the transesterification reaction. Comparative sequence analysis with characterized cardiolipin synthases from E. coli and other bacteria could help identify these domains. Additionally, the enzyme likely contains hydrophobic regions for membrane association, as it functions at the membrane interface where its substrates are located.

What purification strategies are effective for recombinant Pcc cardiolipin synthase?

Purification of recombinant Pcc cardiolipin synthase would likely require a multi-step approach optimized for membrane-associated proteins. Based on successful purification of other bacterial proteins, the following strategy is recommended:

  • Expression optimization: Express the protein with an affinity tag (His6 or GST) in an E. coli strain optimized for membrane protein expression.

  • Membrane extraction: Isolate bacterial membranes by ultracentrifugation after cell lysis.

  • Detergent solubilization: Screen detergents (DDM, LDAO, or Triton X-100) for optimal protein extraction while maintaining enzymatic activity.

  • Affinity chromatography: Purify using Ni-NTA (for His-tagged protein) or glutathione resin (for GST-tagged protein).

  • Size exclusion chromatography: Further purify and assess oligomeric state using gel filtration.

Protein purity can be assessed by SDS-PAGE, and activity can be confirmed using in vitro assays measuring either substrate consumption or product formation by LC-MS, similar to approaches used for MhCls characterization .

How should researchers design assays to measure Pcc cardiolipin synthase activity?

An effective assay system for Pcc cardiolipin synthase activity would include:

  • Substrate preparation: Prepare phosphatidylglycerol liposomes or micelles in a buffer system containing divalent cations (likely Mg²⁺, Ca²⁺, or Zn²⁺, which are often required for enzyme activity, as seen with CaroS4K ).

  • Reaction conditions:

    • Buffer: Typically Tris-HCl or HEPES at pH 7.0-8.0

    • Temperature: Initially test at 30°C, 37°C, and 50°C (noting that CaroS4K has optimal activity around 50°C )

    • Time course: 0, 15, 30, 60, and 120 minutes

  • Product analysis: Monitor cardiolipin formation using:

    • Thin-layer chromatography (TLC) for initial screening

    • LC-MS for precise quantification and product identification

    • Radiolabeled substrates for high sensitivity measurements

  • Controls:

    • Heat-inactivated enzyme

    • Reactions without enzyme

    • Reactions with known cardiolipin synthase inhibitors

This methodological approach allows for quantitative assessment of enzymatic parameters including Km, Vmax, and substrate preference, providing comprehensive characterization of the enzyme's catalytic properties.

How can site-directed mutagenesis be used to study the catalytic mechanism of Pcc cardiolipin synthase?

Site-directed mutagenesis represents a powerful approach to investigate the catalytic mechanism of Pcc cardiolipin synthase. The recommended methodology includes:

Key residues to target would likely include conserved acidic amino acids (aspartate, glutamate) that might coordinate divalent metal ions required for catalysis, as cardiolipin synthesis enzymatic activity often requires metal cofactors like Mg²⁺, Ca²⁺, or Zn²⁺, similar to the requirements observed for CaroS4K DNase activity .

How can researchers address inconsistent activity in purified recombinant Pcc cardiolipin synthase?

Inconsistent activity in purified recombinant Pcc cardiolipin synthase can stem from multiple factors. A systematic troubleshooting approach includes:

  • Protein stability assessment:

    • Monitor protein stability using thermal shift assays

    • Add glycerol (10-20%) to storage buffers to enhance stability

    • Test different pH conditions (range 6.5-8.5) for optimal stability

    • Include reducing agents (DTT or β-mercaptoethanol) if cysteine residues are present

  • Cofactor requirements:

    • Screen various divalent metal ions (Mg²⁺, Ca²⁺, Zn²⁺, Mn²⁺) at different concentrations

    • Based on the findings with CaroS4K, which requires Mg²⁺, Ca²⁺, and Zn²⁺ for its DNase activity , similar metal dependencies might exist for Pcc cardiolipin synthase

  • Detergent optimization:

    • Test multiple detergents for protein solubilization

    • Consider using lipid nanodiscs or proteoliposomes to provide a more native-like membrane environment

  • Storage conditions:

    • Avoid freeze-thaw cycles

    • Store small aliquots at -80°C

    • Test activity preservation with additives like trehalose or sucrose

  • Expression system evaluation:

    • Compare protein expressed in different E. coli strains

    • Consider codon optimization for improved expression

This methodical approach helps identify critical factors affecting enzyme stability and activity, leading to more reproducible experimental outcomes.

What approaches help resolve contradictory data regarding substrate specificity of Pcc cardiolipin synthase?

When confronted with contradictory data regarding substrate specificity of Pcc cardiolipin synthase, researchers should implement the following structured approach:

  • Standardized substrate preparation:

    • Use chemically defined, highly pure lipid substrates

    • Characterize substrate preparations (purity, aggregation state) using analytical techniques before enzymatic assays

    • Prepare consistent liposome or micelle formulations with controlled size distributions

  • Comprehensive analytical methods:

    • Employ multiple orthogonal techniques for product analysis (TLC, LC-MS, enzymatic coupled assays)

    • Conduct time-course experiments to detect transient intermediates

    • Use internal standards for quantification

  • Competition experiments:

    • Perform assays with mixtures of potential substrates to determine preference, similar to studies with MhCls that revealed formation of hybrid cardiolipins when both archaetidylglycerol and phosphatidylglycerol were present

  • Enzyme concentration effects:

    • Test substrate specificity at varying enzyme concentrations to rule out concentration-dependent artifacts

  • Influence of reaction conditions:

    • Systematically vary pH, temperature, and ionic strength to determine if specificity shifts under different conditions

By implementing this comprehensive analysis framework, researchers can resolve apparent contradictions in substrate specificity data and develop a more nuanced understanding of the enzyme's catalytic versatility.

What statistical methods are appropriate for analyzing kinetic data from Pcc cardiolipin synthase assays?

Appropriate statistical analysis of kinetic data from Pcc cardiolipin synthase assays should incorporate:

  • Enzyme kinetics modeling:

    • Fit data to appropriate models (Michaelis-Menten, allosteric, or biphasic kinetics)

    • Use non-linear regression rather than linearization methods (e.g., Lineweaver-Burk plots) for more accurate parameter estimation

    • Consider global fitting approaches when analyzing multiple datasets simultaneously

  • Statistical validation:

    • Calculate 95% confidence intervals for all kinetic parameters

    • Perform residual analysis to validate model fit

    • Use AIC (Akaike Information Criterion) or BIC (Bayesian Information Criterion) for model selection when comparing different kinetic models

  • Replication and variability assessment:

    • Conduct experiments with at least three biological replicates

    • Include technical replicates (minimum of three) for each biological replicate

    • Report standard error or standard deviation appropriately

  • Comparative analysis:

    • Apply ANOVA with post-hoc tests when comparing multiple conditions

    • Use paired t-tests for before/after comparisons with the same enzyme preparation

  • Multivariate analysis for complex datasets:

    • Apply principal component analysis or other dimensionality reduction techniques when examining effects of multiple variables (pH, temperature, ionic strength)

    • Consider response surface methodology for optimization of multiple parameters simultaneously

This statistical framework ensures robust interpretation of kinetic data and facilitates meaningful comparisons between wild-type and mutant enzymes or between different reaction conditions.

What are promising approaches for studying the physiological role of cardiolipin synthase in Pcc?

Understanding the physiological significance of cardiolipin synthase in Pcc would benefit from these investigative approaches:

  • Gene knockout studies:

    • Generate cls gene knockout strains using CRISPR-Cas9 or traditional homologous recombination methods

    • Phenotypically characterize mutants for growth rate, stress resistance, and virulence

    • Perform complementation studies to confirm phenotype specificity

  • Membrane composition analysis:

    • Compare lipid profiles of wild-type and cls mutant strains using lipidomics

    • Examine membrane physical properties (fluidity, curvature) using fluorescence anisotropy or electron microscopy

    • Investigate changes in membrane protein localization and function

  • Environmental adaptation studies:

    • Examine cls expression and cardiolipin content under various stresses (pH, osmotic pressure, temperature)

    • Study cardiolipin synthesis during plant infection processes

    • Investigate potential coordination with bacteriocin production systems, which are well-characterized in Pcc

  • Protein interaction networks:

    • Identify proteins that interact with cardiolipin synthase using pull-down assays or crosslinking studies

    • Map the cardiolipin-interacting proteome to understand functional implications

This multifaceted approach would provide comprehensive insights into how cardiolipin synthesis contributes to Pcc physiology and pathogenicity, potentially revealing new targets for controlling this plant pathogen.

How might structural biology approaches enhance our understanding of Pcc cardiolipin synthase?

Structural biology approaches offer powerful insights into Pcc cardiolipin synthase function and mechanism:

  • X-ray crystallography pathway:

    • Optimize purification to obtain highly homogeneous protein

    • Screen crystallization conditions extensively, focusing on membrane protein-specific screens

    • Consider co-crystallization with substrates, products, or inhibitors

    • Use lipidic cubic phase techniques if traditional approaches fail

  • Cryo-electron microscopy approach:

    • Prepare samples in detergent micelles, nanodiscs, or amphipols

    • Collect high-resolution data and perform 3D reconstruction

    • Determine enzyme structure in different conformational states

    • Visualize the enzyme within membrane context if possible

  • Computational modeling:

    • Generate homology models based on related structures

    • Perform molecular dynamics simulations to understand membrane interactions

    • Use docking studies to predict substrate binding modes

    • Apply quantum mechanics/molecular mechanics approaches to model the reaction mechanism

  • Spectroscopic techniques:

    • Use NMR for dynamics studies of smaller domains

    • Apply EPR with site-directed spin labeling to track conformational changes

    • Employ FTIR to monitor substrate binding and catalysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.