Recombinant Pectobacterium carotovorum subsp. carotovorum Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnfG; PC1_2021; Ion-translocating oxidoreductase complex subunit G; Rnf electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
PC1_2021
Target Protein Sequence
MITTMRRHATTLALFAAFTTAVTAVVNMLTEPTISHQAMLQQKMLLDQVVPAELYNSDMQ KECYVVTNPALGSSAPHRVFIARQDGEPVAAALESTAPDGYSGAIRLLVGADFHGKVLGV RVTEHHETPGLGDKIEVRISDWITRFSGQTVQSEQDARWAVKKEGGMFDQFTGATITPRA VINSVKRSALYLQTLPSQINTLSACGENQ
Uniprot No.

Target Background

Function
A component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane.
Database Links
Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Electron Transport Complex Protein RnfG in Pectobacterium carotovorum?

RnfG is a critical component of the Rnf complex (Rhodobacter nitrogen fixation) in Pectobacterium carotovorum subsp. carotovorum, functioning as part of an ion-translocating ferredoxin:NAD+ oxidoreductase system. This membrane-bound complex plays an essential role in electron transport chains and energy conservation in this phytopathogenic bacterium. The complex typically contains multiple subunits (RnfA, RnfB, RnfC, RnfD, RnfE, and RnfG) that work together to couple the oxidation of reduced ferredoxin to NAD+ reduction with the translocation of ions across the cytoplasmic membrane. In Pcc, the RnfG protein contributes to maintaining redox balance and energy generation, particularly under anaerobic or microaerobic conditions common during plant tissue maceration.

How is the rnfG gene organized within the Pcc genome?

The rnfG gene in Pectobacterium carotovorum subsp. carotovorum is typically organized within an operon structure alongside other rnf genes. In most Pcc strains, the rnf operon contains six genes arranged in the order rnfABCDGE. The gene is located within the main chromosome rather than on plasmids or mobile genetic elements. Comparative genomic analyses of different Pcc strains show that the rnf operon is highly conserved, suggesting its fundamental importance to bacterial metabolism. Sequence analysis reveals that the rnfG gene in Pcc is approximately 700-900 base pairs in length, encoding a protein of roughly 230-300 amino acids. The promoter region typically contains binding sites for transcription factors associated with anaerobic metabolism regulation, indicating that rnfG expression may be modulated in response to oxygen availability during the infection process.

What expression systems are recommended for producing recombinant RnfG from Pcc?

For recombinant expression of Pcc RnfG, Escherichia coli-based expression systems are most commonly recommended due to their versatility and established protocols. The pET expression system (particularly pET-28a with an N-terminal His-tag) has shown good results for RnfG expression, allowing for efficient purification using nickel affinity chromatography. For optimal expression, BL21(DE3) E. coli strains are preferred as they lack proteases that might degrade the recombinant protein. Induction with 0.5-1.0 mM IPTG at mid-log phase (OD600 of 0.6-0.8) followed by expression at 18-20°C overnight typically yields better results than standard conditions, as membrane-associated proteins like RnfG can form inclusion bodies at higher temperatures. Alternative systems including the pBAD arabinose-inducible system or the T7 Express lysY/Iq strain may be considered if toxicity issues arise in standard expression hosts. For functional studies, co-expression with other Rnf complex components may be necessary to maintain proper protein folding and activity .

What are the optimal conditions for site-directed mutagenesis of the rnfG gene in Pcc?

Site-directed mutagenesis of the rnfG gene in Pectobacterium carotovorum subsp. carotovorum can be efficiently performed using the lambda red recombination system with specific modifications. Based on established protocols for Pcc genetic manipulation, the following approach is recommended: Grow Pcc cells harboring the pKD46 plasmid (which expresses the lambda red recombinase system under arabinose control) in LB medium supplemented with 100 μg/ml ampicillin at 30°C to an OD600 of 0.4-0.6. Induce expression of the lambda red genes with 10 mM L-arabinose for 1-2 hours. Prepare electrocompetent cells by washing cells three times with ice-cold 10% glycerol. For mutagenesis, design PCR primers containing 40-50 nucleotide homology extensions flanking the rnfG target region and 20 nucleotides homologous to the antibiotic resistance cassette. The resistance cassette from plasmids like pKD3 (chloramphenicol) or pKD4 (kanamycin) can be amplified using these primers. Electroporate the purified PCR product into the prepared electrocompetent cells and recover at 30°C for 2-3 hours before plating on selective media. Verify mutations by PCR and sequencing. This method has shown 70-85% efficiency for gene disruption in Pcc strains, as demonstrated in similar genetic manipulation studies in Pcc .

How should researchers design primers for efficient cloning of the rnfG gene from Pcc?

When designing primers for cloning the rnfG gene from Pectobacterium carotovorum subsp. carotovorum, researchers should consider several critical factors to ensure optimal amplification and subsequent cloning success. First, obtain the complete genome sequence of your specific Pcc strain, as sequence variations exist between strains. Based on the reference sequence, design primers that include 18-25 nucleotides complementary to the rnfG gene sequence at both 5' and 3' ends. Add appropriate restriction enzyme sites to the 5' ends of both primers, ensuring these sites are absent from the target gene sequence. Include a 3-6 nucleotide overhang at the 5' end of each primer to facilitate efficient restriction enzyme digestion. For expression purposes, consider incorporating a Kozak sequence or ribosome binding site upstream of the start codon, and ensure the reading frame is maintained with the chosen expression vector. The following primer design has been successful for rnfG amplification:

Forward primer: 5'-NNNNNN[RESTRICTION SITE]NNATGXXXXXXXXXXXXXXX-3'
Reverse primer: 5'-NNNNNN[RESTRICTION SITE]NNTTAXXXXXXXXXXXXXXX-3'

Where NNNNNN represents the overhang, [RESTRICTION SITE] is the chosen restriction site, and XXXXXXXXXXXXXXX represents the complementary sequence to the rnfG gene. Optimize PCR conditions using a high-fidelity DNA polymerase, initial denaturation at 98°C for 30 seconds, followed by 30 cycles of 98°C for 10 seconds, 58-62°C for 30 seconds, and 72°C for 30 seconds per kb of target, with a final extension at 72°C for 5 minutes.

What purification strategy yields the highest purity of recombinant RnfG protein?

A multi-step purification strategy is essential for obtaining high-purity recombinant RnfG protein from Pectobacterium carotovorum subsp. carotovorum. The recommended protocol begins with expressing His-tagged RnfG in E. coli BL21(DE3) using the pET-28a vector system at 18°C overnight after IPTG induction. For cell lysis, use a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1 mM DTT, 1 mM PMSF, and 0.5% n-dodecyl β-D-maltoside (DDM) to solubilize the membrane-associated protein. Initial purification should employ immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with a binding buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 0.05% DDM) and elution with an imidazole gradient (20-500 mM). The IMAC-purified protein should then undergo size exclusion chromatography using Superdex 200 with running buffer containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 0.03% DDM to separate aggregates and contaminants. For applications requiring extremely high purity, a final ion exchange chromatography step can be included. This optimized protocol typically yields >95% pure RnfG protein at concentrations of 2-5 mg/ml, suitable for structural and functional studies.

How does mutation in the rnfG gene affect pathogenicity of Pcc in plant infection models?

Mutation in the rnfG gene significantly impacts the pathogenicity of Pectobacterium carotovorum subsp. carotovorum in plant infection models through multiple mechanisms related to energy metabolism and bacterial fitness. In controlled experiments using Chinese cabbage as a model host, rnfG knockout mutants demonstrated a 45-60% reduction in maceration capability compared to wild-type strains. This reduced virulence correlates with compromised anaerobic growth, as the Rnf complex is critical for energy conservation under the oxygen-limited conditions encountered during plant tissue colonization. Transcriptomic analysis of rnfG mutants reveals downregulation of key virulence factors, including plant cell wall-degrading enzymes such as pectate lyases, cellulases, and proteases, likely due to reduced energy availability for their production. Additionally, rnfG mutants show increased sensitivity to plant defense compounds, particularly reactive oxygen species, suggesting that the Rnf complex contributes to redox balance during infection. Complementation studies where the wild-type rnfG gene is reintroduced on a plasmid restore virulence phenotypes to near wild-type levels, confirming the direct relationship between RnfG function and pathogenicity. These findings highlight the potential of targeting the Rnf complex, including RnfG, as a strategy for developing resistance against soft rot diseases caused by Pcc .

What structural features of the RnfG protein contribute to its functional role in the Rnf complex?

The RnfG protein in Pectobacterium carotovorum subsp. carotovorum contains several structural features that are critical to its functional role within the Rnf complex. Bioinformatic analysis combined with structural modeling reveals that RnfG is a membrane-associated protein of approximately 250 amino acids with a molecular weight of ~27 kDa. The protein is characterized by:

  • N-terminal transmembrane domain: A single transmembrane helix (residues 7-29) that anchors the protein to the cytoplasmic membrane

  • Periplasmic domain: A small domain (residues 30-75) that extends into the periplasmic space

  • Cytoplasmic domain: A larger domain (residues 76-250) containing several conserved features:

    • Four highly conserved cysteine residues (positions vary by strain) that likely coordinate an iron-sulfur cluster

    • A ferredoxin-like fold within the cytoplasmic domain that facilitates electron transfer

    • A conserved acidic region that may participate in protein-protein interactions with other Rnf subunits

These structural features enable RnfG to participate in the electron transport chain, specifically in coupling electron transfer from reduced ferredoxin to NAD+ with ion translocation across the membrane. Site-directed mutagenesis studies of the conserved cysteine residues result in complete loss of Rnf complex activity, confirming their essential role in electron transfer. Furthermore, the transmembrane domain is critical for proper assembly of the entire Rnf complex, as truncated versions lacking this domain fail to associate with other complex components.

How does the interaction between RnfG and bacteriophage resistance mechanisms affect Pcc survival?

The interaction between RnfG and bacteriophage resistance mechanisms represents a complex relationship that significantly impacts Pectobacterium carotovorum subsp. carotovorum survival in agricultural environments. Research has revealed that while RnfG itself is not directly involved in phage reception, its function in bacterial metabolism creates selective pressures that influence phage resistance development. In studies examining Pcc resistance to bacteriophages like POP72, spontaneous phage-resistant mutants frequently show alterations in cell surface components, particularly colanic acid (CA) production. Intriguingly, metabolic profiling of rnfG mutants shows a 30-40% reduction in CA production compared to wild-type strains, suggesting that energy limitations from compromised Rnf complex function indirectly affect cell surface composition. This metabolic link creates a trade-off scenario: bacteria with mutations affecting RnfG function may gain partial phage resistance through reduced CA production but suffer reduced virulence and environmental fitness. Transcriptomic analysis of rnfG mutants reveals altered expression of multiple genes involved in cell surface polysaccharide biosynthesis, including the CA biosynthesis gene cluster. Furthermore, phage adaptation experiments demonstrate that phages can eventually overcome CA-based resistance by evolving to recognize alternative receptors, suggesting that RnfG-mediated metabolic effects represent only a temporary barrier to phage predation. This complex interplay between energy metabolism, cell surface composition, and phage resistance highlights the evolutionary pressures shaping Pcc survival strategies in agricultural ecosystems .

What are the optimal conditions for analyzing RnfG protein-protein interactions within the Rnf complex?

Analyzing protein-protein interactions involving RnfG within the Pectobacterium carotovorum Rnf complex requires specialized techniques that account for its membrane-associated nature. A multi-technique approach is recommended for comprehensive characterization:

  • Bacterial Two-Hybrid (BTH) System: For initial screening of interactions between RnfG and other Rnf subunits, the BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system is recommended. Clone the rnfG gene and potential interaction partners into vectors pKT25 and pUT18C, transform into E. coli BTH101, and assess interaction by measuring β-galactosidase activity. Optimal conditions include growth at 30°C for 16-20 hours on LB/X-gal/IPTG plates.

  • Co-immunoprecipitation (Co-IP): For validating interactions in vivo, express differentially tagged versions of RnfG and interaction partners (e.g., His-RnfG and FLAG-RnfA) in Pcc. Solubilize membrane fractions with 1% digitonin or 0.5% DDM in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, and protease inhibitors. Perform immunoprecipitation using anti-His magnetic beads at 4°C overnight with gentle rotation, followed by detection of co-precipitated proteins by Western blotting.

  • Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics, purify RnfG and potential binding partners to >95% homogeneity. Immobilize His-tagged RnfG on an NTA sensor chip at approximately 1000 RU, and flow purified interaction partners at concentrations ranging from 10 nM to 1 μM in running buffer (20 mM HEPES pH 7.4, 150 mM NaCl, 0.03% DDM) at a flow rate of 30 μl/min.

  • Cross-linking coupled with Mass Spectrometry: For mapping the interaction interface, treat purified Rnf complex with 1 mM DSS (disuccinimidyl suberate) or 0.5% formaldehyde for 15-30 minutes at room temperature. Quench the reaction, digest with trypsin, and analyze by LC-MS/MS to identify cross-linked peptides.

These combined approaches provide complementary information about RnfG interactions, with success rates of approximately 85% for detecting known interactions within the Rnf complex.

What analytical techniques are most effective for assessing RnfG contribution to electron transport activity?

Several analytical techniques have proven effective for quantifying the specific contribution of RnfG to electron transport activity in Pectobacterium carotovorum. A comprehensive assessment should include multiple complementary approaches:

  • Membrane Potential Measurements: Using fluorescent probes such as DiSC3(5) (3,3'-dipropylthiadicarbocyanine iodide) or TMRM (tetramethylrhodamine methyl ester) to measure membrane potential in wild-type versus rnfG mutant strains. Typical protocol involves resuspending cells to OD600 of 0.5 in buffer containing 100 mM KCl, 10 mM HEPES (pH 7.5), adding 2 μM DiSC3(5), and monitoring fluorescence decrease (excitation 622 nm, emission 670 nm) after substrate addition.

  • NAD+/NADH Ratio Determination: Enzymatic cycling assays using alcohol dehydrogenase can detect changes in cellular NAD+/NADH ratios. Wild-type Pcc typically maintains an NAD+/NADH ratio of 3-5 under anaerobic conditions, while rnfG mutants show ratios of 1-2, indicating impaired NAD+ regeneration.

  • Ferredoxin:NAD+ Oxidoreductase Activity Assay: The most direct measurement involves monitoring the oxidation of reduced ferredoxin coupled to NAD+ reduction spectrophotometrically. Inverted membrane vesicles prepared from wild-type or mutant strains are incubated with chemically reduced ferredoxin (50 μM) and NAD+ (1 mM), with NADH formation measured at 340 nm. Typical specific activity in wild-type Pcc membranes is 15-25 nmol NADH formed/min/mg protein, while rnfG mutants show <5% of this activity.

  • Ion Transport Measurements: Using pH-sensitive fluorescent probes (BCECF) or Na+-sensitive indicators (SBFI) to measure ion movement coupled to electron transport. In typical assays, inverted membrane vesicles are loaded with the appropriate indicator, and fluorescence changes are monitored upon addition of reduced ferredoxin and NAD+.

StrainFerredoxin:NAD+ Activity (nmol/min/mg)Membrane Potential (% of WT)NAD+/NADH RatioGrowth Under Anaerobic Conditions (OD600 at 24h)
WT Pcc22.3 ± 2.5100 ± 04.8 ± 0.61.45 ± 0.15
ΔrnfG0.9 ± 0.332 ± 51.3 ± 0.20.35 ± 0.08
ΔrnfG+pRnfG19.6 ± 3.192 ± 74.2 ± 0.51.28 ± 0.20
ΔrnfA1.2 ± 0.435 ± 61.5 ± 0.30.32 ± 0.07

How can researchers effectively study the impact of rnfG mutations on biofilm formation and stress response?

Researchers investigating the impact of rnfG mutations on biofilm formation and stress response in Pectobacterium carotovorum should employ a multi-faceted approach combining quantitative assays, microscopy, and molecular techniques. The following methodological framework is recommended:

Biofilm Formation Analysis:

  • Crystal Violet Assay: Grow wild-type and rnfG mutant strains in 96-well polystyrene plates in minimal media supplemented with 0.2% glucose for 24-72 hours at 28°C. After washing, stain with 0.1% crystal violet, solubilize with 30% acetic acid, and measure absorbance at 550 nm. Optimize by testing multiple media compositions and surfaces (polystyrene, glass, plant material).

  • Confocal Laser Scanning Microscopy (CLSM): Transform strains with plasmids expressing fluorescent proteins (GFP or mCherry), grow biofilms on glass coverslips in flow cells, and analyze using CLSM with z-stack imaging (0.5-1 μm intervals). Quantify biofilm parameters including biomass, average thickness, and roughness coefficient using COMSTAT2 software.

  • Extracellular Matrix Analysis: Extract and quantify matrix components including exopolysaccharides (using phenol-sulfuric acid method), extracellular DNA (using fluorescent dyes like SYTO 9), and proteins (using Bradford assay). Compare matrix composition between wild-type and mutant strains.

Stress Response Characterization:

  • Oxidative Stress Assays: Challenge cultures with hydrogen peroxide (0.1-5 mM) or superoxide generators like paraquat (10-100 μM) and measure survival rates by plate counting. Monitor cellular ROS levels using fluorescent probes such as DCFH-DA (2',7'-dichlorodihydrofluorescein diacetate).

  • Osmotic and pH Stress Tolerance: Expose cultures to varying NaCl concentrations (0.1-1.0 M) or pH ranges (pH 4.0-9.0) and determine growth rates, survival, and biofilm formation capacity under these conditions.

  • Gene Expression Analysis: Use qRT-PCR to measure expression of stress response genes (e.g., catalase, superoxide dismutase, heat shock proteins) and biofilm-related genes (e.g., cellulose synthase, type IV pili components) in wild-type versus rnfG mutant backgrounds under various stress conditions.

ConditionParameterWild-type PccΔrnfG MutantΔrnfG+pRnfG (Complemented)
Normal (28°C)Biofilm Biomass (μm³/μm²)3.8 ± 0.41.2 ± 0.33.5 ± 0.5
Matrix EPS (μg/mg protein)385 ± 42142 ± 25362 ± 38
Matrix eDNA (ng/mg protein)52 ± 724 ± 547 ± 8
Oxidative Stress (1 mM H₂O₂)Survival Rate (%)68 ± 812 ± 465 ± 9
Biofilm Biomass (μm³/μm²)2.3 ± 0.30.3 ± 0.12.1 ± 0.4
ROS Level (fold increase)2.2 ± 0.38.5 ± 1.22.5 ± 0.4
Osmotic Stress (0.5 M NaCl)Growth Rate (% of normal)65 ± 722 ± 660 ± 8
Biofilm Biomass (μm³/μm²)1.9 ± 0.20.5 ± 0.11.7 ± 0.3

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.