Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. This protein anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
KEGG: pct:PC1_3761
STRING: 561230.PC1_3761
Fumarate reductase subunit D (frdD) is a small hydrophobic protein (13 kDa) that forms part of the membrane-bound fumarate reductase complex in Pectobacterium carotovorum subsp. carotovorum. The protein consists of 118 amino acids and contains hydrophobic domains that anchor the fumarate reductase complex to the bacterial membrane. The amino acid sequence is: MINPTPKRSDEPPFWGLFGAGGMWSAFFAPVIILLVGIMLPLGLFPDALTYERIAAFSQSFIGRVFLLLMIVLPIWCGLHRIHHAMHDLKIHVPAGKWVFYGLAAILTVVTVIGVVTL .
Fumarate reductase is a critical enzyme in anaerobic respiration of many bacteria, catalyzing the reduction of fumarate to succinate, which serves as the terminal electron acceptor in the absence of oxygen. The D subunit specifically provides membrane anchorage for the catalytic components (A, B, and C subunits) of the complex. This enables P. carotovorum to survive and proliferate in oxygen-limited environments such as within infected plant tissues, where oxygen availability may be restricted due to tissue maceration and water-soaking caused by the pathogen.
Recombinant frdD protein should be stored in a Tris-based buffer containing 50% glycerol that has been optimized for protein stability. For short-term storage (up to one week), the protein can be kept at 4°C. For extended storage, -20°C is recommended, with -80°C being optimal for long-term preservation. Importantly, repeated freezing and thawing cycles should be avoided as they may compromise protein integrity and activity. Working aliquots should be prepared and stored at 4°C for routine use .
When designing PCR-based detection assays for Pectobacterium species, researchers should consider:
Primer specificity: Select genetic targets with sufficient nucleotide differences to discriminate between closely related species. For P. carotovorum identification, the Pcar1F/R primers targeting variable segments of the 16S rRNA gene and intergenic spacer region offer improved specificity compared to previously available primers like EXPCCF/R .
Assay format: Conventional PCR produces a 1,190-bp amplicon with Pcar1F/R primers, while real-time PCR offers increased sensitivity but at higher cost. The choice depends on whether qualitative identification or quantitative detection is needed .
Cross-reactivity testing: New assays should be validated against multiple species within the genus (e.g., P. atrosepticum, P. brasiliensis, P. parmentieri) to ensure specificity. Note that the Pcar1F/R primers cannot differentiate between P. carotovorum and P. versatile .
Sample preparation: When working with plant material, particularly potato tubers, special attention should be given to removal of PCR inhibitors that may be present in plant tissues.
Real-time PCR offers several advantages over conventional PCR for identification of P. carotovorum:
Improving specificity in distinguishing between closely related Pectobacterium species requires a multi-faceted approach:
Multi-locus analysis: Targeting multiple genomic regions can increase discrimination power. Combining the Pcar1F/R assay (targeting P. carotovorum/P. versatile) with PW7011F/R primers (targeting P. parmentieri/P. wasabiae) allows comprehensive identification of potato-associated species .
Melting curve analysis: In real-time PCR, analyzing melting profiles helps differentiate specific amplicons from primer dimers or non-specific products. The P. carotovorum amplicon exhibits a reproducible melting temperature of 87.4°C .
Sequential approach: A stepwise identification protocol starting with genus-specific primers followed by species-specific primers can reduce false positives.
Genomic target selection: Utilizing variable regions like the 16S-23S intergenic spacer rather than conserved genes increases discriminatory power. The Pcar1F/R primers were designed on a variable segment of the 16S rRNA gene and intergenic spacer region, providing improved specificity over existing methods .
Validation across diverse strains: Testing newly developed assays against multiple strains of each target and non-target species ensures reliable performance.
Recombinant frdD protein can be used in multiple experimental approaches to study host-pathogen interactions:
Immunolocalization: Using antibodies against recombinant frdD to track the localization of the fumarate reductase complex during infection.
Metabolic profiling: Comparing fumarate/succinate ratios in infected tissues to understand the role of anaerobic respiration during pathogenesis.
Protein-protein interaction studies: Identifying plant proteins that may interact with the bacterial fumarate reductase complex during infection using recombinant frdD as bait.
Structural studies: Using purified recombinant protein for crystallization and structural determination to understand membrane integration.
Enzyme kinetics: Reconstituting the fumarate reductase complex in vitro to study its activity under different conditions that mimic the plant environment during infection.
To study frdD's role in bacterial adaptation to plant environments, researchers can employ these methodological approaches:
Gene expression analysis: Measuring frdD expression levels under different oxygen concentrations, pH conditions, and in the presence of plant extracts using RT-qPCR.
Mutagenesis studies: Creating frdD knockout mutants and complemented strains to assess virulence, growth, and survival in plant tissues.
Comparative genomics: Analyzing sequence conservation and variation of frdD across Pectobacterium isolates from different hosts to identify adaptation signatures.
In planta imaging: Using fluorescently tagged strains to visualize bacterial colonization patterns in relation to oxygen gradients within plant tissues.
Metabolic flux analysis: Tracing carbon flow through central metabolism during infection to determine the contribution of fumarate reduction to bacterial fitness.
Common causes of false negative results in PCR detection of P. carotovorum include:
PCR inhibition: Potato tissues contain polyphenols, polysaccharides, and other inhibitory compounds that can interfere with PCR amplification. Using specialized DNA extraction methods with CTAB (cetyltrimethylammonium bromide) or commercial plant DNA extraction kits can help overcome this issue .
Low bacterial concentration: In early infection stages, bacterial populations may be below detection limits. Enrichment steps in selective media before PCR can increase sensitivity.
Primer binding site mutations: Variations in the target region among different strains can affect primer binding. Using multiple primer sets targeting different regions can address this issue.
Improper sample collection: Bacteria may be unevenly distributed in infected tissues. Collecting samples from the margin between healthy and diseased tissue increases detection probability.
DNA degradation: Improper sample storage or processing can lead to DNA degradation. Fresh samples or appropriate preservation methods should be used.
When working with recombinant frdD protein, implement these quality control measures:
Purity assessment: Verify protein purity using SDS-PAGE to ensure the preparation is free from contaminating proteins.
Identity confirmation: Confirm protein identity through Western blotting with specific antibodies or mass spectrometry analysis.
Structural integrity: Assess secondary structure using circular dichroism spectroscopy, particularly important for membrane proteins like frdD.
Functional assays: Even though frdD is not the catalytic subunit, confirm its ability to associate with other fumarate reductase subunits to form a functional complex.
Stability monitoring: Implement regular testing of stored protein aliquots to ensure they maintain their properties over time. Avoid repeated freeze-thaw cycles as mentioned in storage recommendations .
Batch consistency: Compare different production batches for consistency in purity, concentration, and activity when used in experimental protocols.
Understanding frdD and the fumarate reductase complex can contribute to sustainable control strategies through:
Targeted inhibitor development: Identifying specific inhibitors that disrupt fumarate reductase function could lead to novel bactericides with lower environmental impact than broad-spectrum antibiotics.
Resistance breeding: Identifying plant genotypes that create environmental conditions unfavorable for fumarate reductase activity could guide breeding programs.
Oxygen management: Since fumarate reductase functions in anaerobic conditions, agricultural practices that improve oxygen penetration into tubers during storage could reduce bacterial proliferation.
Competitive exclusion: Developing non-pathogenic bacterial strains with more efficient fumarate reductase systems could outcompete pathogens in the rhizosphere.
Biocontrol integration: Understanding how bacteriophages like PP1 (which target P. carotovorum) interact with bacteria under different respiratory conditions could improve biocontrol efficacy.
When studying interactions between frdD and host immune responses, researchers should consider:
Protein preparation: Ensure that recombinant frdD maintains its native conformation. For membrane proteins like frdD, this may require specialized expression systems and detergent solubilization.
PAMP recognition: Determine whether frdD or peptides derived from it can act as pathogen-associated molecular patterns (PAMPs) recognized by plant pattern recognition receptors.
Temporal dynamics: Monitor immune responses at multiple time points after exposure to frdD to capture both early and late responses.
Concentration gradients: Test different protein concentrations to identify physiologically relevant dosages that trigger immune responses.
Tissue specificity: Compare responses in different plant tissues, as immune reactions may vary between leaves, stems, and tubers.
Control proteins: Include appropriate controls such as heat-denatured frdD and recombinant proteins from non-plant pathogens to distinguish specific from non-specific responses.