Recombinant Pectobacterium carotovorum subsp. carotovorum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pectobacterium carotovorum subsp. carotovorum Large-Conductance Mechanosensitive Channel (MscL)

The large-conductance mechanosensitive channel (MscL) is a protein found in bacteria that responds to mechanical stimuli . Specifically, MscL opens a large pore in the cell membrane when the turgor pressure increases . This mechanism allows the cell to relieve excessive pressure. MscL was the first mechanosensitive ion channel to be identified in bacteria .

Pectobacterium carotovorum is a bacterium known to cause soft rot disease in plants . The recombinant form of Pectobacterium carotovorum subsp. carotovorum MscL refers to the protein produced using genetic engineering techniques . This involves isolating the MscL gene from P. carotovorum and expressing it in a different host organism, such as E. coli or yeast, to produce large quantities of the protein for research purposes .

Role of MscL in Bacterial Physiology

MscL functions as a tension-activated pore, limiting excessive turgor pressure in bacteria . The channel opens in response to mechanical stress, allowing ions and small molecules to flow across the membrane, thereby reducing the pressure .

Research Findings and Applications

  • Identification of Differentially Expressed Proteins: Studies have identified proteins in Pectobacterium carotovorum subsp. carotovorum that are differentially expressed under different conditions, such as in vitro (with plant extracts) and in vivo (in plant tissues) . These proteins play roles in virulence, and MscL could potentially interact with these proteins or be influenced by the same regulatory mechanisms .

  • Quorum Sensing and Virulence: Research on quorum sensing in Pectobacterium carotovorum has shown that inactivation of genes like expI can reduce the production of plant cell wall-degrading enzymes and reduce virulence . MscL's role in maintaining cell membrane integrity might be crucial under conditions of stress caused by virulence factors or the host plant's defenses .

  • Biocontrol Strategies: Bacteriophages like PP1 have been shown to effectively control Pectobacterium carotovorum subsp. carotovorum . Understanding the physiological responses of the bacteria, including the role of MscL under phage attack, could provide insights for enhancing biocontrol strategies .

  • Modulation of MscL Channel Gating: Approaches to modulate mechanosensitive MscL channel function have been explored, including the use of mutations and chemical modifications . These studies provide insights into the structure-function relationship of MscL and could lead to the development of therapeutics targeting bacterial mechanosensitivity .

Table Summarizing Key Properties of Recombinant Pectobacterium carotovorum subsp. carotovorum MscL

PropertyDescription
Protein NameLarge-conductance mechanosensitive channel (MscL)
Source OrganismPectobacterium carotovorum subsp. carotovorum
FunctionMechanosensitive ion channel; opens in response to increased turgor pressure
Subunit StructureHomopentamer; five identical subunits
Transmembrane DomainsTwo transmembrane domains per subunit
Key Structural FeatureHydrophobic seal formed by residues near the membrane face of TMS1; disruption leads to gain-of-function
Role in CellProtects against excessive turgor pressure by opening a pore for ions and small molecules
Recombinant ProductionExpressed in hosts like E. coli, Yeast, Baculovirus or Mammalian cells for research purposes
ApplicationsDrug discovery, therapeutics against bacteria

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mscL; PC1_3793; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVSDIIMPPLGLLIGGVDFKQFSLI LRDAQGEVPAVVMNYGAFIQNIFDFVIVAFAIFMAIKLMNKLRRKQEDEPAAPPKPSAEE KLLAEIRDLLKEQQPKQ
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Pectobacterium carotovorum and why is it significant for agricultural research?

Pectobacterium carotovorum is a gram-negative bacterium belonging to the family Pectobacteriaceae (formerly classified under the genus Erwinia). It is a ubiquitous plant pathogen with an exceptionally diverse host range that includes many agriculturally and scientifically important plant species such as potato, carrot, tomato, leafy greens, cucurbits, onion, and green peppers .

The pathogen is particularly significant because it produces pectolytic enzymes that hydrolyze pectin between individual plant cells, causing the cells to separate - a condition known as bacterial soft rot . It specifically causes beet vascular necrosis and blackleg of potato, making it economically devastating for potato production worldwide. P. carotovorum is currently divided into four described subspecies: carotovorum, brasiliense, odoriferum, and actinidiae .

The bacterium is most destructive under high humidity and temperatures around 30°C (86°F), conditions that favor disease development . Understanding its pathogenicity mechanisms is crucial for developing effective control strategies to reduce significant post-harvest losses in agriculture.

What are mechanosensitive channels and what is the specific role of mscL in bacterial physiology?

Mechanosensitive channels are membrane protein complexes that respond to mechanical forces in the cell membrane. In bacteria, these channels act as emergency release valves that open in response to increased membrane tension, typically during osmotic downshock when bacteria move from a high to low osmolarity environment.

The large-conductance mechanosensitive channel (mscL) represents one of the largest membrane channels in bacteria. When activated, mscL forms a wide pore that allows the rapid efflux of cytoplasmic solutes, preventing cell lysis during severe osmotic stress. The channel exhibits several key characteristics:

  • It responds to membrane tension rather than specific ligands

  • It has a high conductance, allowing passage of molecules up to 30 Daltons

  • It remains closed under normal physiological conditions

  • It opens transiently during hypoosmotic stress

In P. carotovorum, mscL likely plays critical roles during the infection process, potentially including:

  • Protection against osmotic challenges encountered when moving between plant intercellular environments

  • Possible involvement in virulence factor secretion

  • Adaptation to changing osmotic conditions during tissue maceration caused by pectolytic enzymes

Understanding mscL function in P. carotovorum provides insights into how this pathogen maintains cellular integrity during the infection process.

What are the recommended protocols for cloning and expressing recombinant P. carotovorum mscL?

The cloning and expression of recombinant P. carotovorum mscL requires careful consideration of several methodological aspects. A systematic approach involves:

Step 1: Gene Identification and Primer Design

  • Identify the mscL gene sequence from P. carotovorum genome databases

  • Design primers with appropriate restriction sites for downstream cloning

  • Include sequences for affinity tags (His6 or FLAG) for purification purposes

Step 2: PCR Amplification and Cloning

  • Extract genomic DNA from P. carotovorum using standard bacterial DNA isolation protocols

  • Amplify the mscL gene using high-fidelity DNA polymerase

  • Clone the amplified product into an appropriate expression vector

Step 3: Expression System Selection
The choice of expression system is critical for membrane proteins like mscL. Consider using:

Expression SystemAdvantagesLimitations
E. coli BL21(DE3)High yield, simple cultivationPotential folding issues with membrane proteins
E. coli C43(DE3)Specialized for membrane proteinsLower yield than standard BL21
Cell-free systemsAvoids toxicity issuesExpensive, technically challenging
P. carotovorum-based systemsNative environment for foldingLess established expression protocols

Step 4: Optimization of Expression Conditions

  • Test different induction temperatures (typically 16-30°C)

  • Vary inducer concentrations (IPTG: 0.1-1.0 mM)

  • Optimize induction time (4-24 hours)

Step 5: Protein Extraction and Purification

  • Harvest cells and disrupt by sonication or French press

  • Solubilize membrane fraction using appropriate detergents (DDM, LDAO, or Triton X-100)

  • Purify using affinity chromatography followed by size exclusion chromatography

For functional studies, it's advisable to verify protein folding and activity using techniques such as circular dichroism spectroscopy or patch-clamp electrophysiology.

How can researchers effectively generate and characterize mscL knockout mutants in P. carotovorum?

Generation of mscL knockout mutants in P. carotovorum requires careful planning and execution. Based on established protocols for Pectobacterium gene deletion, the following methodology is recommended:

Lambda Red Recombination System Approach:

  • Design primers containing 40-50 bp homology arms flanking the mscL gene and sequences to amplify an antibiotic resistance cassette (e.g., kanamycin)

  • Amplify the resistance cassette with these primers

  • Transform P. carotovorum cells harboring a plasmid expressing lambda Red recombinase

  • Induce recombinase expression and introduce the PCR product

  • Select transformants on appropriate antibiotic media

This approach is similar to the method used for generating the P. carotovorum expI mutant described in the literature . Confirmation of successful knockout should involve:

  • PCR verification using primers that flank the insertion site

  • Southern blot analysis to confirm single insertion of the antibiotic cassette

  • Sequencing of the modified genomic region

  • Complementation studies by introducing the wild-type gene in trans

For characterization, perform comparative phenotypic analyses between wild-type and mutant strains:

  • Growth curve analysis under standard and hypoosmotic conditions

  • Survival rates following osmotic downshock

  • Virulence assays on host plants (particularly potato tubers and stems)

  • Microscopy to examine changes in cellular morphology

  • Transcriptomic analysis to identify compensatory mechanisms

As observed with the expI mutant strain, in vitro growth rates should be compared with wild-type to ensure any observed phenotypic differences are not due to general growth defects .

How does mscL function intersect with quorum sensing pathways in P. carotovorum virulence?

The intersection between mechanosensitive channel function and quorum sensing (QS) represents an intriguing research frontier. While direct evidence linking these systems in P. carotovorum is limited, several potential interactions can be investigated:

Experimental Approach to Investigate mscL-QS Interactions:

  • Comparative Transcriptomics: Analyze mscL expression in wild-type versus QS-defective mutants (e.g., P. carotovorum ΔexpI) under various osmotic conditions. Evidence from studies with the expI mutant strain demonstrates that QS regulates multiple virulence factors and appendage genes . Similar regulatory control might extend to osmoregulatory systems including mscL.

  • Dual Mutant Analysis: Generate mscL/expI double mutants and compare their phenotypes with single mutants regarding:

    • Colonization patterns in plant tissue

    • Virulence factor production

    • Osmotic stress responses

    • Biofilm formation capacity

  • Signaling Molecule Transport: Investigate whether mscL channels participate in the transport or sensing of acyl homoserine lactones (AHLs) or other QS signal molecules. This could be tested by measuring AHL accumulation in mscL mutants versus wild-type strains.

  • Mechanical Signal Integration: Analyze whether mechanical signals sensed by mscL contribute to the regulation of QS-controlled genes, particularly under conditions that mimic the plant intercellular environment.

Research with P. carotovorum ΔexpI mutants has revealed that QS deficiency results in reduced production of plant cell wall-degrading enzymes (PCWDEs), inability to produce AHLs, and reduced virulence in potato tubers and stems . Colonization patterns show that QS-deficient bacteria aggregate in intercellular spaces but fail to transit to xylem tissue . Whether mscL function contributes to these phenotypes through osmoregulation during tissue colonization warrants investigation.

A framework for understanding potential relationships between QS and mscL function might include:

Cellular ProcessQS RegulationPotential mscL Involvement
Virulence factor productionDirect regulation via ExpI/ExpRPossible role in secretion or response to osmotic changes during PCWDE activity
MotilityQS regulates flagella expressionmscL may influence flagellar function through osmotic balance maintenance
Biofilm formationQS regulates attachment factorsmscL might contribute to surface attachment sensing
Vascular colonizationQS required for xylem invasionmscL potentially involved in adaptation to osmotic conditions in vascular tissue

What role does mscL play in the adaptation of P. carotovorum to osmotic challenges during plant infection?

P. carotovorum encounters diverse osmotic environments during the infection process, from the relatively dry plant surface to the aqueous intercellular spaces and eventually the xylem vessels. mscL likely plays critical roles in this adaptive process:

During Early Infection:
As P. carotovorum initiates infection, it transitions from external plant surfaces to intercellular spaces. This transition involves exposure to plant defense mechanisms including rapid ion fluxes that alter osmolarity. mscL may provide protection against osmotic downshock during this phase.

During Tissue Maceration:
The production of PCWDEs by P. carotovorum leads to tissue maceration and the release of cellular contents, creating a rapidly changing osmotic environment. Evidence shows that wild-type P. carotovorum forms aggregates within xylem tissue of potato stems , while QS-deficient mutants aggregate in intercellular spaces but fail to invade xylem tissue. This colonization pattern may partially depend on proper osmotic adaptation facilitated by mscL.

Experimental Approaches for Investigation:

  • Real-time in planta imaging: Using fluorescently tagged mscL proteins to visualize channel localization and activation during different infection stages.

  • Tissue-specific osmolarity measurements: Measuring the osmotic environment in different plant tissues before and after infection.

  • Strain comparison under controlled osmotic conditions: Testing wild-type, mscL mutant, and complemented strains for:

    • Growth in media with fluctuating osmolarity

    • Survival following osmotic downshock

    • Ability to colonize plant tissues with different osmotic properties

  • Electrophysiological studies: Patch-clamp analysis of mscL activity in response to plant-derived compounds.

The transmission electron microscopy and confocal laser microscopy techniques used to study P. carotovorum colonization patterns would be valuable for examining mscL mutant phenotypes during infection, particularly focusing on:

  • Bacterial aggregation patterns

  • Movement from intercellular spaces to xylem

  • Structural changes in bacterial membranes during osmotic adaptation

What are the best techniques for measuring mscL channel activity in P. carotovorum?

Measuring mechanosensitive channel activity in P. carotovorum requires specialized techniques that can detect the rapid opening and closing of these channels in response to membrane tension. Several complementary approaches are recommended:

1. Patch-Clamp Electrophysiology:
The gold standard for measuring mscL activity involves patch-clamp techniques applied to:

  • Giant spheroplasts generated from P. carotovorum

  • Reconstituted channels in liposomes or planar lipid bilayers

  • Heterologous expression systems (e.g., Xenopus oocytes)

Key parameters to measure include:

  • Channel conductance (typically 3-3.5 nS for mscL)

  • Gating threshold (membrane tension required for activation)

  • Open probability as a function of membrane tension

  • Channel kinetics (opening and closing rates)

2. Fluorescence-Based Methods:

  • FRET-based tension sensors incorporated into or near mscL

  • Fluorescence quenching assays using liposomes loaded with self-quenching fluorescent dyes

  • Single-molecule fluorescence microscopy to track conformational changes

3. Cellular Assays:

  • Downshock survival assays comparing wild-type and mscL mutants

  • E. coli MJF455 complementation (mscL-deficient strain rescue)

  • Solute release measurements following osmotic downshock

Data Analysis Considerations:

TechniqueKey ParametersAnalysis ApproachPotential Artifacts
Patch-clampConductance, thresholdNon-linear curve fittingPipette pressure artifacts
FRETEnergy transfer efficiencyRatio analysisPhotobleaching
Downshock survivalColony forming unitsLog-transformation, ANOVAGrowth rate differences
Solute releaseRelease kineticsFirst-order kineticsMembrane damage

When analyzing mscL activity data, researchers should consider:

  • Normalizing measurements to membrane area or protein concentration

  • Accounting for differences in membrane composition between preparations

  • Comparing activity across multiple experimental conditions

  • Correlating in vitro measurements with in vivo phenotypes

How can researchers effectively analyze gene expression data related to mscL regulation during infection?

Analyzing gene expression data for mscL during P. carotovorum infection requires careful experimental design and robust analytical approaches. Based on methodologies used for studying other P. carotovorum virulence genes , the following framework is recommended:

Experimental Design:

  • Temporal sampling: Collect samples at multiple time points post-infection (e.g., 6, 24, 48, and 72 hours) to capture dynamic expression changes, similar to the approach used for studying expression of PCWDEs, flagella, and pili genes .

  • Spatial sampling: Isolate bacteria from different plant tissue locations (surface, intercellular spaces, vascular tissue) to understand context-specific expression.

  • Controls: Include appropriate reference genes for normalization (e.g., 16S rRNA, recA) and compare expression across multiple experimental conditions:

    • In vitro vs. in planta growth

    • Different osmotic environments

    • Wild-type vs. regulatory mutants

Quantitative RT-PCR Analysis:

  • Primer design: Design primers specific to mscL and reference genes, with efficiency validation across a range of template concentrations.

  • Data normalization: Apply multiple reference gene normalization using algorithms such as geNorm or NormFinder.

  • Relative quantification: Calculate relative expression using the 2^-ΔΔCt method with appropriate error propagation.

  • Statistical analysis: Apply appropriate statistical tests (ANOVA with post-hoc tests) to determine significant expression differences.

RNA-Seq Analysis Pipeline:

  • Quality control: Filter and trim raw reads based on quality scores

  • Alignment: Map reads to the P. carotovorum genome

  • Quantification: Count reads mapping to mscL and other genes

  • Normalization: Apply TPM, RPKM, or DESeq2 normalization

  • Differential expression: Identify significant changes in mscL expression

  • Pathway analysis: Identify co-regulated genes and potential regulatory networks

Integration with Other Data Types:

Gene expression data should be integrated with:

  • Protein levels (Western blot or proteomics)

  • Channel activity measurements

  • Phenotypic assays (virulence, colonization patterns)

  • Regulatory element analysis (promoter studies)

For P. carotovorum, gene expression analysis has revealed that flagella are part of the quorum sensing regulon, while fimbriae and pili are negatively regulated by quorum sensing . Similar regulatory relationships may exist for mscL, potentially linking osmotic adaptation to broader virulence mechanisms.

How can understanding mscL function in P. carotovorum contribute to developing novel control strategies?

Understanding mscL function in P. carotovorum offers several promising avenues for developing novel control strategies against this economically important pathogen. The integration of basic research findings into practical applications involves:

Target-Based Control Approaches:

  • Chemical inhibitors: Identifying compounds that specifically block mscL function could provide new bacteriostatic agents. Potential screening approaches include:

    • High-throughput electrophysiology

    • In silico molecular docking

    • Structure-based drug design targeting the channel pore or gating mechanism

  • Genetic resistance: Engineering plant varieties with altered apoplastic osmolarity or compounds that interfere with mscL function.

  • Biocontrol strategies: Developing antagonistic microbes that create osmotic conditions unfavorable for P. carotovorum survival.

Research to Application Pathway:

Research PhaseKey InvestigationsPotential Applications
Basic characterizationStructure-function studies of mscLIdentification of targetable sites
Regulatory network analysisHow mscL interacts with virulence pathwaysDisruption of virulence coordination
In planta functionRole during different infection stagesStage-specific intervention strategies
Population geneticsVariation in mscL across strainsBroad-spectrum control development

Experimental Validation Approaches:

  • Storage condition optimization: Based on understanding how mscL functions at different temperatures and humidity levels, develop storage protocols that minimize P. carotovorum virulence activation.

  • Field trials: Test mscL-targeting compounds under controlled and field conditions, assessing:

    • Reduction in disease incidence

    • Crop yield impact

    • Environmental safety

    • Resistance development potential

Research on P. carotovorum has demonstrated that disruption of specific virulence regulators like expI can significantly reduce bacterial virulence in potato tubers and stems . Similar approaches targeting mscL or its regulatory pathways could prove effective, particularly if they interfere with the pathogen's ability to transit from intercellular spaces into xylem vessels, a critical step in disease progression .

What are the most significant technical challenges in studying recombinant mscL in P. carotovorum and how can they be overcome?

Studying recombinant mscL in P. carotovorum presents several significant technical challenges that researchers must address:

Challenge 1: Membrane Protein Expression and Purification
Mechanosensitive channels are membrane proteins that are often difficult to express and purify in functional form.

Solutions:

  • Use specialized E. coli strains (C43, Lemo21) designed for membrane protein expression

  • Optimize detergent selection for solubilization (test panel including DDM, LDAO, CHAPS)

  • Apply nanodiscs or amphipol systems for stabilization

  • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Implement gentle purification protocols with stability screens

Challenge 2: Maintaining Native Function in Recombinant Systems
Ensuring that recombinant mscL maintains native functionality in experimental systems.

Solutions:

  • Validate channel function using multiple complementary approaches

  • Compare activity parameters between native and recombinant channels

  • Test functionality in mutant complementation assays

  • Assess structure using CD spectroscopy or limited proteolysis

  • Verify membrane insertion using protease accessibility assays

Challenge 3: Studying mscL Function in planta
Understanding channel behavior during actual infection processes.

Solutions:

  • Develop fluorescent reporter systems compatible with plant imaging

  • Create tension-sensitive FRET biosensors for in planta measurements

  • Establish microfluidic systems that mimic plant apoplastic conditions

  • Apply single-cell techniques to bacteria isolated from infected plants

  • Use inducible promoter systems to control mscL expression during infection

Challenge 4: Correlating in vitro Findings with in vivo Function
Bridging the gap between controlled laboratory experiments and actual pathogenicity.

Solutions:

  • Establish clear phenotypic readouts for mscL function during infection

  • Develop assays that correlate with specific infection stages

  • Create conditional mutants with tunable mscL expression

  • Apply systems biology approaches to map mscL into virulence networks

  • Use comparative studies across multiple P. carotovorum strains

The development of transformation and gene disruption protocols similar to those used for generating the P. carotovorum expI mutant provides a foundation for genetic manipulation in this organism. Researchers studying mscL can adapt these approaches, utilizing lambda recombination systems and triparental mating for generating targeted mutants . Additionally, the confocal microscopy techniques established for tracking bacterial colonization patterns in plant tissues can be adapted for studying how mscL mutations affect the infection process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.